Die Präsentation wird geladen. Bitte warten

Die Präsentation wird geladen. Bitte warten

Aufgabe 1 Ein kleines Protein (siehe Sequenz) wurde mit dem Enzym Trypsin inkubiert. Typsin hydrolysiert Peptidbindungen nach Arginin und Lysin. a. Ordnen.

Ähnliche Präsentationen


Präsentation zum Thema: "Aufgabe 1 Ein kleines Protein (siehe Sequenz) wurde mit dem Enzym Trypsin inkubiert. Typsin hydrolysiert Peptidbindungen nach Arginin und Lysin. a. Ordnen."—  Präsentation transkript:

1 Aufgabe 1 Ein kleines Protein (siehe Sequenz) wurde mit dem Enzym Trypsin inkubiert. Typsin hydrolysiert Peptidbindungen nach Arginin und Lysin. a. Ordnen Sie die entstehenden Peptide in einer Tabelle. Geben Sie für jedes Peptid die Ladung an. Nehmen Sie als p H -Wert 7. b. Ändert sich die Ladung der Peptide, wenn Sie als p H -Wert 5 annehmen? DEVLTQSPLSLPVTPGQPASISCRSSEDLLESDGNYLDWYLQKPGESPQLLI YLGSNRASGVHNRFSGSGSGTNFTLKISRVEAEDVGVYYCMQALQTPLTPGH GTNVEIRTVAAPSVFI

2 Aufgabe 2 –S–S–V–V––S–S–V–V– N C Sie haben ein partiell gefaltetes Protein (siehe Figur) in wässriger Lösung bei 25°C und p H = 7. Berechnen Sie Δ G' für die Faltung des Tetrapeptids S-S-V-V in den Kern des partiell gefalteten Proteins: a. wenn alle polaren Gruppen interne H... Brücken bilden b. wenn die polaren Seitenketten keine internen H... Brücken bilden c. wenn überhaupt keine polaren Gruppen interne H... Brücken bilden d. unter welchen Bedingungen (a, b, c) wird das Protein fertig gefaltet Machen Sie folgende Annahmen: jede polare Seitenkette kann eine H... Brücke bilden 2 neue H 2 0 Moleküle bilden mit anderen H 2 0 Molekülen eine H... Brücke die 3 Peptidbindungen zwischen den 4 Aminosäuren können zwei H... Brücken pro Peptidbindung bilden bei der Bildung einer H... Brücke werden 10 KJ/mol freigesetzt beim Falten von hydrophoben Seitenketten in den Kern werden 20 KJ/mol freigesetzt

3 Lösung 1 DEVLTQSPLSLPVTPGQPASISCRSSEDLLESDGNYLDWYLQKPGESPQLLI YLGSNRASGVHNRFSGSGSGTNFTLKISRVEAEDVGVYYCMQALQTPLTPGH GTNVEIRTVAAPSVFI Peptid Ladung pH 7Ladung pH 5 DEVLTQSPLSLPVTPGQPASISCR SSEDLLESDGNYLDWYLQK-4 PGESPQLLIYLGSNR00 ASGVHNR+1+2 FSGSGSGTNFTLK+1 ISR+1 VEAEDVGVYYCMQALQTPLTPGHGTNVEIR-3-2 TVAAPSVFI00 negativ, positiv

4 Lösung 2a a. Alle polaren Gruppen bilden interne H... Brücken. 8 H... Brücken mit Wasser werden gebrochen+ 80 KJ/mol 8 interne H... Brücken werden gebildet- 80 KJ/mol 8 freigesetzte H 2 0 Moleküle bilden 4 H... Brücken- 40 KJ/mol 2 hydrophobe Seitenketten gehen in den Proteinkern- 40 KJ/mol Δ G' =- 80 KJ/mol

5 Lösung 2b b. Die polaren Seitenketten bilden keine internen H... Brücken. 8 H... Brücken mit Wasser werden gebrochen+ 80 KJ/mol 6 interne H... Brücken werden gebildet- 60 KJ/mol 8 freigesetzte H 2 0 Moleküle bilden 4 H... Brücken- 40 KJ/mol 2 hydrophobe Seitenketten gehen in den Proteinkern- 40 KJ/mol Δ G' = - 60 KJ/mol

6 Lösung 2c c. Keine polaren Gruppen bilden interne H... Brücken. 8 H... Brücken mit Wasser werden gebrochen+ 80 KJ/mol 0 interne H... Brücken werden gebildet 0 KJ/mol 8 freigesetzte H 2 0 Moleküle bilden 4 H... Brücken- 40 KJ/mol 2 hydrophobe Seitenketten gehen in den Proteinkern- 40 KJ/mol Δ G' = 0 KJ/mol Protein faltet unter Bedingungen a und b.


Herunterladen ppt "Aufgabe 1 Ein kleines Protein (siehe Sequenz) wurde mit dem Enzym Trypsin inkubiert. Typsin hydrolysiert Peptidbindungen nach Arginin und Lysin. a. Ordnen."

Ähnliche Präsentationen


Google-Anzeigen