Die Präsentation wird geladen. Bitte warten

Die Präsentation wird geladen. Bitte warten

Oliver Kohlbacher Angewandte Bioinformatik Zentrum für Bioinformatik Tübingen Oliver Kohlbacher Angewandte Bioinformatik Zentrum für Bioinformatik Tübingen.

Ähnliche Präsentationen


Präsentation zum Thema: "Oliver Kohlbacher Angewandte Bioinformatik Zentrum für Bioinformatik Tübingen Oliver Kohlbacher Angewandte Bioinformatik Zentrum für Bioinformatik Tübingen."—  Präsentation transkript:

1 Oliver Kohlbacher Angewandte Bioinformatik Zentrum für Bioinformatik Tübingen Oliver Kohlbacher Angewandte Bioinformatik Zentrum für Bioinformatik Tübingen

2 Masernimpfung 2

3 Eine kurze Geschichte der Immunologie 430 BC: Peleponnesischer Krieg Thucydides beschreibt die Pest – Menschen, die die Seuche überleben, können andere Kranke pflegen, ohne wieder zu erkranken 15. Jahrhundert Chinesen und Türken verwenden getrocknete Pockenkruste als „Impfstoff“ 1798 Edward Jenner – Pockenimpfstoff 1881 Louis Pasteur – abgeschwächte Erreger als Impfstoff 3

4 Vaccinia und Variola Die Pocken werden durch das Variola-Virus verursacht Die Krankheit verläuft meist tödlich und hat insgesamt mehr Tote gefordert als die Pest Verwandt mit dem Variola-Virus ist das Vaccinia-Virus, das die Kuhpocken verursacht, aber für Menschen harmlos ist 4 Pocken

5 Jenners Experiment Im Jahre 1788 war es allgemein bekannt, dass Milchmädchen, die Kuhpocken ausgesetzt waren, KEINE Pocken bekamen Edward Jenner infizierte einen 8 Jahre alten Jungen mit Kuhpocken Anschließender Kontakt mit Pocken führte nicht zu einer Infektion Impfstoffe („Vakzine“) waren erfunden (lateinisch “vacca” bedeutet “Kuh”)  Schutz vor Infektion kann durch “Vakzinierung” erreicht werden 5

6 Pasteurs erstes Experiment Im Jahre 1881 gelang es Louis Pasteur, Cholera- Bakterien zu kultivieren und zu zeigen, dass die Injektion der Bakterien in Hühner die Krankheit hervorruft Führte das Experiment mit einer alten Kultur durch (nach seinem Sommerurlaub) Hühner wurden krank, erholten sich aber wieder Verwendete eine frische Kultur an den gleichen Hühnern: sie überlebten wieder  Abgeschwächte Bakterien können als Impfstoff verwendet werden 6

7 Pasteurs zweites Experiment Im Jahre 1881 impfte Pasteur Schafe mit einem durch Hitze abgeschwächten Milzbrand-Stamm Setzte sowohl vakzinierte als auch nicht vakzinierte Schafe Milzbrand aus Alle vakzinierten Schafe überlebten, alle anderen starben Dieses Experiment stellt den Beginn der Immunologie als Wissenschaft dar 7

8 Vakzinierung Die Verbreitung vieler Infektionskrankheiten ist stark zurückgegangen, seit Vakzinierung üblich geworden ist Diphtherie, Masern, Keuchhusten, Röteln, Poliomyelitis und Tetanus Pocken wurden ausgerottet Einige Herausforderungen bleiben Malaria, Tuberkulose, und HIV Krebsimpfstoffe Verbesserung der Sicherheit und Zuverlässigkeit existierender Impfstoffe, sowie Reduzierung der Nebenwirkungen 8

9 Immunomik Das interdisziplinäre Gebiet, das Immunologie, Immunoinformatik, Genomik, Proteomik, Bioinformatik und verwandte wissenschaftliche Gebiete umfasst. (Definition der International Immunomics Society) Wir beschäftigen uns hier mit Computergestützter Immunomik oder Immunoinformatik Wir werden auch die nicht-informatischen Aspekte betrachten, allerdings nicht sehr detailliert 9

10 Computergestützte Immunomik (alias Immunoinformatik, Computergestützte Immunologie, Theoretische Immunologie) Definition Die Anwendung von Methoden der Bioinformatik auf Probleme, die das menschliche Immunsystem betreffen. 10

11 Immunomik – Hauptziele Rationaler Impfstoffentwurf (CAVD, Computer-Aided Vaccine Design) Infektionskrankheiten Tumortherapie Verständnis des Immunsystems (Theoretische Immunologie) Molekulare Ebene (Erkennung von Antigenen …) Gesamter Organismus (Dynamik der Immunantwort) 11

12 Das Immunsystem Funktion Das Immunsystem schützt Tiere vor pathogenen Mikroorganismen und Anomalien (z.B. Krebs) Aufbau Besteht aus einer großen Menge von Zellen und Molekülen, die in der Lage sind „Fremdkörper“ zu erkennen und zu eliminieren Ein enges und dynamisches Zusammenspiel zwischen den unterschiedlichen Teilen 12

13 Adaptive Immunität Um ein Antigen erkennen zu können, müssen die Zellen des Immunsystem mit dem Antigen in Berührung kommen Das wird durch membrangebundene Rezeptoren auf spezialisierten Zellen erreicht 13

14 Humorale und zelluläre Immunität 14

15 CTLs CTLs töten infizierte Zellen durch Einleitung der Apoptose 15

16 MHC-Klasse-I-Moleküle Peptide, die ins ER transportiert wurden, können an MHC-Klasse-I- Moleküle binden MHC = Haupthistokompatibilitätskomplex (major histocompatibility complex), ein Genlocus, der mit T-Zell- vermittelter Immunität zusammen- hängt MHC ist eine Ansammlung von Genen, die über einen langen Abschnitt von Chromosom 6 verteilt sind Wird bei Menschen auch HLA (human leukocyte antigen) genannt 16

17 MHC-Klasse-I-Struktur Cytoplasma Extrazellulärer Raum 17

18 MHC-Klasse-I-Peptide Die Bindefurche ist groß genug, um Peptide der Länge 8 – 10 Aminosäuren aufzunehmen 18

19 MHC-Allele Die MHC-Region ist sehr stark polymorph: für die Klasse-I- Loci existieren viele Tausende von Genvarianten (Allele) Diploides Genom: je zwei (evtl. verschiedene) Kopien der drei Klasse-I- und der drei Klasse-II-MHC-Gene Jeder Mensch besitzt also zwischen drei und sechs verschiedene MHC-Varianten jeder Klasse mit unterschiedlichen Spezifitäten für die Peptidbindung 19

20 MHC-Klasse-I-Bindetaschen 20

21 Epitopvorhersage Problem: Gegeben eine Antigensequenz und eine Menge von Zielallelen, welche Teilsequenzen sind Epitope? 21 …PSSVQTEKKKKSDGKIKKDEDRYKTRDLWNNFSYF PEITHIVIKESTVSINKQDNKKMELKLSSHDEALSF ASLIDGYFRLTADAHHYLCTDVAPPLIEHNIKNGCH GPICTEYAINRLRQEG… 21

22 MHC-Klasse-I-Peptidbindung Jedes Allel bindet eine große Anzahl unterschiedlicher Peptide, jedes mit einer anderen Bindestärke (Affinität) Ob ein Peptid bindet wird bestimmt durch seine freie Bindungsenthalpie  G MHC + P ­ MHC:P  G < 0 : Binder  G > 0 : Nichtbinder  G wird dominiert von Wasserstoffbrücken zwischen Peptid und MHC Hydrophobe Wechselwirkungen (Peptidseitenketten mit hydrophoben Bindetaschen) Elektrostatische Wechselwirkungen 22

23 Einfache Vorhersageansätze Die ersten Ansätze zur Epitopvorhersage basieren auf einem Vergleich bekannter Epitope Multiple Alignments lassen bevorzugte Residuen für bestimmte Positionen erkennen Die meisten Allele haben Ankerpositionen mit einer hohen Selektivität bzgl. spezifischer Aminosäuren HLA-A*02:01 scheint L und V an Positionen 2 und 9 zu bevorzugen 23 (A*02:01)

24 Von Motiven zu Profilen Motive ermöglichen nur eine binäre Klassifikation (Binder vs. Nichtbinder) Keine Möglichkeit quantitative Daten darzustellen 24 XLXXXXXXV kommt 3x vor XIXXXXXXV kommt 2x vor Gibt es einen besseren Weg, dies darzustellen (unter der Annahme, dass die Beobachtungshäufigkeit eine Art Präferenz bzgl. eines Motivs widerspiegelt)?

25 Positionsspezifische Scoring-Matrizen PSSMs können aus alinierten Sequenzen eines bestimmten MHC- Allels generiert werden. Jeder Aminosäure a kann an jeder Position p des Peptids eine Wahrscheinlichkeit zugeordnet werden Die Wahrscheinlichkeit p(A) das Peptid A=a 1 a 2 …a p zu beobachten, kann folgendermaßen berechnet werden: Neben der Multiplikation von Wahrscheinlichkeiten ist auch die Addition von Scores (oder Logarithmen von Wahrscheinlichkeiten) gängig 25 Lund et al., p. 71

26 Positionsspezifische Scoring-Matrizen Beispiel: BIMAS-Matrix für HLA-A*02:01 26 P1P2P3P4P5P6P7P8P9 A C10, D0,0750,10,44,1110,4910,003 E0,0751,40,0644,1110,4910,003 F4,60,053,713,81,95,85,50,015 G10, ,1310,015 H0,0340, ,015 I1,79,91112,310,412,1 K3,50,10, ,003 L1,7723,7112,3114,3 M1,7523,7112,3111 N10, ,015 P0,0220, ,003 Q17, ,003 R10,010, ,210,003 S10, ,015 T ,5 V1,76,31112,310,4114 W4,60,018,3111,77,55,50,015 Y4,60,013,2111,515,50,015 Beispiel: Peptid von STAT1 – VLWDRTFSL … Multipliziert mit einer finalen Normalisierungskonstante (0.069) Score: 1.7 x 72 x 8.3 x 4.1 x 1 x 2.3 x 5.8 x 1 x 4.3 x = 16,486

27 27 Maschinelles Lernen Das Gebiet des Maschinellen Lernens beschäftigt sich mit dem Lernen von Vorhersagemodellen aus empirischen Daten – vereinfacht: mache Vorhersagen basierend auf bekannten ähnlichen Daten Typische Methoden sind: Künstliche Neuronale Netzwerke (ANNs, artificial neural networks) Entscheidungsbäume Supportvektormaschinen (SVMs) Universelle Methoden, können verwendet werden für Spracherkennung, Bilderkennung, Vorhersagen von Medikamenteneigenschaften und auch Vorhersagen von MHC-Peptidbindung

28 28 Klassifizierungsprobleme Qualitative Daten (z.B. Binder vs. Nichtbinder) schaffen das leichtere Problem, Peptide in eine Kategorie zu klassifizieren, anstatt IC 50 -Werte vorherzusagen In einem (binären) Klassifizierungsproblem versucht man einer Menge von Features x 1, …, x k, die man als Eingabe erhält, eine bestimmte Klasse y aus einer Menge von (zwei) Klassen zuzuweisen Diese Features werden so gewählt, dass sie Informationen beinhalten, die für das Problem relevant sind Um dieses Problem zu lösen, suchen wir nach einer Funktion, die einen beliebigen Punkt des Eingaberaums auf eine der Klassen abbildet

29 29 Einfache Klassifizierungstechniken Der Klassifizierer muss auf einer Menge von Beispielen bekannter Klasse, den Trainingsdaten, trainiert werden. Das wird überwachtes Lernen genannt, da der Klassifizierer Beispiele für das erhält, was er vorhersagen soll. Nachdem der Klassifizierer derart initialisiert wurde, kann er die Klasse eines beliebigen Punktes im Featureraum vorhersagen. x1x1 x2x2

30 Kodierung von Peptidsequenzen Ein künstliches Neuronales Netz (KNN) ist ein Lernverfahren, das aus Beispielen eine Klassifizierung lernen kann Sequenzen von möglichen Epitopen können binär kodiert werden, um dann von künstlichen neuronalen Netzen gelernt zu werden AAEncoding Ala (A) Cys (C) Asp (D) … … 30

31 KNNs für Epitopvorhersage Analog zu der Verschaltung von Neuronen im Gehirn sind ‘künstliche Neuronen’ in einem KNN miteinander verschaltet (gewichtete Addition) 31 AA1AA2AA3AA4AA5AA6AA7AA8AA9 …

32 Impfstoffentwurf Wie bereits erwähnt, basieren die meisten Impfstoffe auf abgeschwächten Pathogenen In letzter Zeit haben sich epitopbasierte Impfstoffe als interessante Alternative ergeben 32

33 String-of-Beads vs. Peptidmix Peptide können verabreicht werden als Peptidmischungen (A) Zusammengefügt zu einem Polypeptid (B) Zusammengefügt zu einem Polypeptid mit verbindenden Spacersequenzen, die die geeignete Prozessierung sicherstellen (C) B und C sind sog. ‚string of beads‘ (or beads-on-a-string) Impfstoffe, da die Epitope wie Perlen in einer Kette aneinandergereiht werden B und C bestehen aus einer einzelnen Komponente A ermöglicht eine einfachere Synthese und Kombination individueller Peptide 33

34 Epitopbasierte Impfstoffe Grundidee epitopbasierter Impfstoffe ist die rationale Auswahl individueller Epitope Im Gegensatz zu abgeschwächten Vakzinen werden nur diese Epitope verwendet und nicht der gesamte Organismus Hauptziel ist es, den Impfstoff so einfach wie möglich (kleine Anzahl von Komponenten) so wirksam wie möglich (hohe Immunogenität) so breit anwendbar wie möglich (Abdeckung eines Großteils der Bevölkerung) zu machen 34

35 MHC-Allelhäufigkeiten Unterschiedliche Bevölkerungen haben sehr unterschiedliche Allelhäufigkeiten. Data from 35

36 Bevölkerungsoptimierte Impfstoffe Ein Impfstoff, der in Afrika wirksam ist, muss nicht auch in Europa wirksam sein aufgrund unterschiedlicher vorherrschender MHC-Allele Epitopgestützte Impfstoffe sollten auf einer geeigneten Auswahl von Epitopen basieren, die die richtige Bevölkerung abdeckt Ziel Impfstoff sollte für einen ausreichend großen Prozentsatz einer gegebenen Bevölkerung wirksam sein Gleichzeitig: Minimiere die Anzahl der Epitope, die im Impfstoff enthalten sind (problematisch für Zulassung, Qualitätskontrolle, Preis,...) Der Entwurf bevölkerungsoptimierter Impfstoffe stellt ein interessantes Optimierungsproblem dar, das bisher noch nicht gelöst wurde. 36

37 Optimierungsproblem Auswahl der besten Epitope für einen EBV kann als Optimierungsproblem ausgedrückt werden Gegeben: Eine Menge von Antigenen (und ihre Sequenzen) Eine Menge von Allelen und ihre Häufigkeiten (eine Zielbevölkerung) Ziel: Ermittle eine minimale Menge von Epitopen, die die beste Immunantwort liefert 37

38 Optimierungsproblem Toussaint, Dönnes, Kohlbacher, PLoS Comput. Biol., 2008, 4(12): e

39 ILP-basierte Impfstoffoptimierung Formuliere Epitopselektionsproblem als ILP Maximiere die allgemeine Immunogenität in der Zielbevölkerung Hauptannahmen: Immunogenitäten sind additiv, über Allele & über Epitope Wahrscheinlichkeit beeinflusst den Beitrag eines Allels zur allgemeinen Immunogenität direkt Bedingungen Maximale Anzahl von Peptiden/Epitopen Abdeckung einer großen Anzahl von Allelen Abdeckung einer großen Anzahl von Antigenen Vorteil: Findet eine optimale Lösung – keine Heuristik! 39

40 ILP-Formulierung Bedingung:erlaube eine maximale Anzahl von Epitopen Toussaint, Dönnes, Kohlbacher, PLoS Comput. Biol., 2008, 4(12): e Max. Anzahl von Epitopen k, die ausgewählt werden dürfen 40

41 Ergebnisse Allgemeine Immunogenität einer Menge von 10 Epitopen Optimale Lösung liefert eine deutlich bessere allgemeine Immunogenität für die gleiche Anzahl von Epitopen. Toussaint, Dönnes, Kohlbacher, PLoS Comput. Biol., 2008, 4(12): e Benötigte Anzahl von Epitopen, um eine bestimmte Immunogenität (2,700) zu erreichen Optimale Lösung benötigt deutlich weniger Epitope, um das gleiche Immunogenitätslevel zu erreichen 41

42 OptiTope Webserver 42

43 OptiTope Webserver 43

44 OptiTope Webserver 44

45 OptiTope Webserver 45

46 OptiTope Webserver 46

47 OptiTope Webserver 47

48 Zusammenfassung Bioinformatik kann in der Impfstoffentwicklung neue Möglichkeiten eröffnen Moderne Impfstoffe können in kurzer Zeit entwickelt werden und auf Bevölkerungsgruppen oder Individuen optimiert werden Schwierig bleibt nach wie vor die Modellierung des sehr komplexen Immunsystems als Ganzes Zunehmende Datenmengen erlauben aber immer bessere Vorhersagen 48

49 Links Mehr dazu: 4./6. Semester: BIOINF 3360 – Computational Immunomics als Wahlpflichtveranstaltung Bioinformatik Vorlesung „Einführung in die Immunologie“ als Wahlpflichtveranstaltung Lebenswissenschaften 49


Herunterladen ppt "Oliver Kohlbacher Angewandte Bioinformatik Zentrum für Bioinformatik Tübingen Oliver Kohlbacher Angewandte Bioinformatik Zentrum für Bioinformatik Tübingen."

Ähnliche Präsentationen


Google-Anzeigen