Die Präsentation wird geladen. Bitte warten

Die Präsentation wird geladen. Bitte warten

9. VorlesungModern Methods in Drug Discovery WS05/061 Cytochrom P450, Polymorphismus, Transporter.

Ähnliche Präsentationen


Präsentation zum Thema: "9. VorlesungModern Methods in Drug Discovery WS05/061 Cytochrom P450, Polymorphismus, Transporter."—  Präsentation transkript:

1 9. VorlesungModern Methods in Drug Discovery WS05/061 Cytochrom P450, Polymorphismus, Transporter

2 9. VorlesungModern Methods in Drug Discovery WS05/062 Cytochrom P450, Polymorphismus, Transporter Vom Dünndarm (small intestine) aus gelangen aufgenom- mene Xenobiotica über die Pfort Ader (portal vein) in die Leber. Hier finden eine ganze Reihe von biochemischen Modifikationen statt.

3 9. VorlesungModern Methods in Drug Discovery WS05/063 Cytochrom P450 Metabolismus (I) Zuerst: First pass effect Vorwiedend lipophile oder schwere (MW >500) Verbindungen werden ekzessiv metabolisiert Diese werden dadurch hydrophiler und damit leichter ausscheidbar gemacht. Verantwortlich für die als Phase I bezeichneten Reaktionen sind hauptsächlich eine Gruppe von Cytochrom P450 Enzymen (CYP).

4 9. VorlesungModern Methods in Drug Discovery WS05/064 Cytochrom P450 Metabolismus (II) Die Monooxygenierung der Substrate erfolgt in einem katalytischen Zyklus an einem Hämoglobin-Eisen (Fe)

5 9. VorlesungModern Methods in Drug Discovery WS05/065 Cytochrom P450 Metabolismus (III) Die am Metabolismus beteiligten Cytochrome sind überwiegend Monooxygenasen, die evolutionär von der Steroid- und Fettsäuren-biosynthese stammen Im Menschen wurden bisher 17 CYP-Familien mit ungefähr 50 Isoformen charakterisiert Nomenklatur:CYP 3 A 4 Familie >40% Sequenz- homolgie Unterfamilie >55% Sequenz- homolgie Isoenzym *15 A-B Allel

6 9. VorlesungModern Methods in Drug Discovery WS05/066 Cytochrom P450 Gene families CYP450 Human 14+ Plants 22 Insects 3 Fungi 11 Yeasts 2 Nematodes 3 Bacteria 18 Molluscs 1

7 9. VorlesungModern Methods in Drug Discovery WS05/067 Human cytochrome P450 family Aus der Superfamilie der Cytochrome kommen folgende Familien im Menschen vor: CYP 1-5, 7, 8, 11, 17, 19, 21, 24, 26, 27, 39, 46, 51 CYP 1, 2A, 2B, 2C, 2D, 2E, 3Metabolismus von Xenobiotica CYP 2G1, 7, 8B1, 11, 17, 19, 21, 27A1, 46, 51 Steroid Metabolismus CYP 2J2, 4, 5, 8A1Fettsäuren Metabolismus CYP 24 (Vitamin D), 26 (retinoic acid), 27B1 (Vitamin D),...

8 9. VorlesungModern Methods in Drug Discovery WS05/068 Cytochrom P450 Enzyme (I) Flavin Monooxygenase Isoenzyme Alkohol Dehydrogenase Aldehyd Oxidase Monoamin Dehydrogenase (MAO) Die Redoxaktivität wird durch ein Eisenporphyrin im aktiven Zentrum ermöglicht

9 9. VorlesungModern Methods in Drug Discovery WS05/069 Cytochrom P450 Enzyme (II) Trotz der niedrigen Sequenzidentität von CYP aus unterschiedlichen Organismen, ist die Tertiärstruktur hoch konserviert. Gegenüber den bakteriellen CYP besitzen die microsomalen mammalian CYP eine zusätzliche Transmembranhelix als Membrananker Überlagerung von hCYP 2C9 (1OG5.pdb) und CYP 450 BM3 (2BMH.pdb) Bacillus megaterium

10 9. VorlesungModern Methods in Drug Discovery WS05/0610 Cytochrom P450 Enzyme (III) Die überwiegende Menge an CYP befindet sich in der Leber, aber auch in der Dünndarmwand kommen bestimmte vor. Die mammalian CYP sind an das endoplasmatische Reticulum gebunden, also membranständig.

11 9. VorlesungModern Methods in Drug Discovery WS05/0611 Cytochrom P450 Enzyme (IV) Am Metabolismus von endogenden Stoffen sind vor allem CYP 3A4, CYP 2D6, und CYP 2C9 beteiligt.

12 9. VorlesungModern Methods in Drug Discovery WS05/0612 Substratspezifität der CYP (I) Spezifische Substrate der einzelnen human CYP CYP 1A2verapamil, imipramine, amitryptiline, caffeine (arylamine N-oxidation) siehe CYP 2A6nicotine CYP 2C9diclofenac, naproxen, piroxicam, warfarin CYP 2C19diazepam, omeprazole, propanolol CYP 2D6amitryptiline, captopril, codeine, mianserin, chlorpromazine CYP 2E1dapsone, ethanol, halothane, paracetamol CYP 2B6cyclophosphamid CYP 3A4alprazolam, cisapride, terfenadine,...

13 9. VorlesungModern Methods in Drug Discovery WS05/0613 Substratspezifität der CYP (II) Decision tree for human P450 substrates CYP 1A2, CYP 2A-E, CYP 3A4 Lit: D.F.V. Lewis Biochem. Pharmacol. 60 (2000) 293 Volume low high CYP 3A4 CYP 2E1 medium pK a acidic CYP 2C9 basic CYP 2D6 neutral CYP 1A2, CYP 2A, 2B planarity low CYP 2B6 high CYP 1A2 medium CYP 2A6

14 9. VorlesungModern Methods in Drug Discovery WS05/0614 Cytochrom P450 Metabolismus (IV) Im Rahmen der präklinischen Entwicklung ist auch die Erfassung der Metabolite von Wirkstoffen notwendig, da diese u.U. toxisch sein können. Dazu exprimiert man die entsprechenden CYP Enzyme durch Klonierung in E. coli, und verfolgt die Umsetzung der Wirkstoffe mittels Gaschromatographie und Massenspektroskopie. Dies ermöglicht die selektive Bestimmung von Metaboliten durch einzelne Cytochrom P450 Enzyme, bzw. deren genetische Varianten. Diese Ergebnisse werden dann mit den analogen in vivo Ergebnissen aus Tiermodellen verglichen. Lit. zum Klonieren: R.Knippers, Molekulare Genetik 8.Auflage, Kapitel 10

15 9. VorlesungModern Methods in Drug Discovery WS05/0615 Cytochrom P450 Polymorphismus Jeder Mensch ist (mehr oder minder) anderst D.h. der gleiche Genotyp läßt verschiedene Phänotypen zu (Diploider Satz an Chromosomen, differentielle Expression) Der Genotyp widerum ist durch die individuelle DNA Sequenz bestimmt. Der Phänotyp läßt sich anhand der tatsächlichen Aktivität oder der Menge des exprimierten Enzyms unterscheiden. Entsprechend der metabolischen Aktivität unterscheidet man bei CYP normale (extensive metabolizer), schwache (poor metabolizer), und verstärkte (ultra-rapid metabolizer) Umsetzer. Lit: K. Nagata et al. Drug Metabol. Pharmacokin 3 (2002) 167

16 9. VorlesungModern Methods in Drug Discovery WS05/0616 Single Nucleotide Polymorphism (SNP) SNPs sind Unterschiede einer einzelnen Base in der DNA die innerhalb einer Population auftauchen. Als Polymorphismus bezeichnet man Allele die bei mindestens 1% der Population auftreten. D.h. diese Genotypen sind regulär. Im Gegensatz dazu bezeichnet man Veränderungen des Genoms die seltener als 1% auftauchen nur als Mutationen. Typischerweise werden bei seltenen, ererbten Krankheiten Mutationen im kodierenden Bereich von DNA-Abschnitten festgestellt. Lit: A.D. Rose Nature 405 (2000) 857.

17 9. VorlesungModern Methods in Drug Discovery WS05/0617 CYP 2D6 Polymorphismus (I) Am besten untersucht ist der Polymorphismus von CYP 2D6 (Debrisoquine 4-hydroxylase) Siehe: D.B.Goldstein et al. Nature Rev. Genetics 4 (2003) 937. Lokalisiert auf Chromosom 22 Von den 75 Allelen exprimieren 26 Proteine siehe Zuerst für die Umsetzung von debrisoquine und sparteine (Antipsychotica) beschrieben

18 9. VorlesungModern Methods in Drug Discovery WS05/0618 CYP 2D6 Polymorphismus (II) Lit: J. van der Weide et al. Ann. Clin. Biochem 36 (1999) 722

19 9. VorlesungModern Methods in Drug Discovery WS05/0619 MGLEALVPLAVIVAIFLLLVDLMHRRQRWAARYPPGPLPLPGLGNLLHVDFQNTPYCFDQ LRRRFGDVFSLQLAWTPVVVLNGLAAVREALVTHGEDTADRPPVPITQILGFGPRSQGVF LARYGPAWREQRRFSVSTLRNLGLGKKSLEQWVTEEAACLCAAFANHSGRPFRPNGLLDK AVSNVIASLTCGRRFEYDDPRFLRLLDLAQEGLKEESGFLREVLNAVPVLLHIPALAGKV LRFQKAFLTQLDELLTEHRMTWDPAQPPRDLTEAFLAEMEKAKGNPESSFNDENLRIVVA DLFSAGMVTTSTTLAWGLLLMILHPDVQRRVQQEIDDVIGQVRRPEMGDQAHMPYTTAVI HEVQRFGDIVPLGMTHMTSRDIEVQGFRIPKGTTLITNLSSVLKDEAVWEKPFRFHPEHF LDAQGHFVKPEAFLPFSAGRRACLGEPLARMELFLFFTSLLQHFSFSVPTGQPRPSHHGV FAFLVSPSPYELCAVPR CYP 2D6 Polymorphismus (III) siehe poor debrisoquine metabolism SR impaired mechanism of sparteine poor debrisoquine metabolism I poor debrisoquine metabolism R missing in CYP2D6*9 allele P loss of activity in CYP2D6*7 T impaired metabolism of sparteine in alleles 2, 10, 12, 14 and 17 of CYP2D6

20 9. VorlesungModern Methods in Drug Discovery WS05/0620 CYP 2D6 Polymorphismus (III) Variabilität der Debrisoquine-4-Hydroxylierung homocygote extensive metabolizers = metabolic rate = number of individuals (european population) heterocygote extensive metabolizers homocygote poor metabolizers Lit: T. Winkler Deutsche Apothekerzeitung 140 (2000) 38

21 9. VorlesungModern Methods in Drug Discovery WS05/0621 CYP 2D6 Polymorphismus (IV) Der poor metabolizer Phänotyp hat Auswirkungen auf den Metabolismus von mehr als 25% aller gängigen Medikamente, da er zu einer erhöhten Konzentration nicht umgesetzer Xenobiotika führt. Lit: M.P.Murphy et al. Pharmacogenetics 10 (2000) 583. Deshalb wurde CYP2D6 Genotypisierung bereits zur Auswahl geeigneter Testpersonen für die Phase III in klinischen Studien eingesetzt: Lamotrigine, Desipramine (Antidepressiva) Lit: H.K.Kroemer & M.Eichelbaum. Life Sci. 56 (1995) 2285.

22 9. VorlesungModern Methods in Drug Discovery WS05/0622 Polymorphismus weiterer CYPs CYP 1A2 individuell; hohe, mittlere und langsame Umsetzung von caffeine CYP 2B6 fehlt in 3-4 % der kaukasischen Bevölkerung CYP 2C9 Defizit bei 1-3 % der kaukasischen Bev. CYP 2C19 Individuen mit inaktivem Enzym (3-6 % der kaukasischen und % der asiatischen Bevölkerung) CYP 2D6 schwache Metabolisierer bei 5-8 % der europäischen, 10 % der kaukasischen und <1% der japanischen Bevölkerung. Überexpression (doppeltes Gen) bei Teilen der afrikanischen und orientalischen Bev. CYP 3A4 nur geringe Mutationen im Zusammenhang mit dem Polymorphismus des MDR1 Transporter Gen

23 9. VorlesungModern Methods in Drug Discovery WS05/0623 Genotypisierung von CYP P450 Allelen Die Firma Affymetrix (USA) hat unter Verwendung von immobilisierten synthetischen Kopien von P450 Nukleotiden Microarrays (Gen Chips) entwickelt, die die Indentifizierung aller klinisch relevanten Allele erlauben.

24 9. VorlesungModern Methods in Drug Discovery WS05/0624 Induktion und Regelung von CYP3A (I) Man hat eine ganze Reihe von Xenobiotica gefunden die zur verstärkter Exprimierung von Enzymen der CYP3A Familie führen. indinavirAntiviral efavirenz Antiviral cyclosporinImmunosuppressant carbamazepineAnticonvulsant atorvastatinHMG CoA Reductase Inhibitor tamoxifenAntineoplastic, Anti-hormone Diese binden an den pregnane X receptor (PXR) der als Transkriptionsfaktor die expression von des CYP3A Genes reguliert. Lit: T.M. Wilson et al. Nature Rev. Drug Disc. 1 (2002) 259

25 9. VorlesungModern Methods in Drug Discovery WS05/0625 Induktion und Regelung von CYP3A (II) Der PXR Rezeptor wirkt als Heterodimer zusammen mit dem retinoid X receptor (RXR) Als Folge der Induktion von CYP3A kommt es zu verstärktem Metabolismus der aufgenommenen Substanz. Im ungünstigsten Fall kommt es dadurch zu Nebenwirkungen, wie etwa Leberentzündung.

26 9. VorlesungModern Methods in Drug Discovery WS05/0626 RXR und weitere nukleare Rezeptoren (I) Als spezifischen, endogenen Aktivator von RXR hat man 5 -pregnane-3,20-dione gefunden. Im Gegensatz dazu ist PXR sehr viel weniger spezifisch und wird sowohl von Glucocorticoiden als auch von Anti- Glucocorticoiden aktiviert. Der unspezifische constitutive androgen receptor (CAR) findet sich dagegen im Cytoplasma und dimerisiert erst im Nucleus mit RXR. Analog zu PXR wird hier das CYP2B Gen reguliert. Ebenfalls hohe Sequenzhomologie wurde für den vitamin D receptor (VDR) der CYP27 reguliert, und für den arylhydrocarbon receptor (AHR) (Dioxin Rezeptor) gefunden.

27 9. VorlesungModern Methods in Drug Discovery WS05/0627 RXR und weitere nukleare Rezeptoren (II) Diese nuklearen Rezeptoren gehören zu einer Familie von Transkriptionsfaktoren. Jeder besitzt eine doppelte Zink-Finger DNA-Bindungsdomäne (DBD), sowie eine größere Carboxy-terminale Ligandenbindungsdomäne (LBD). Da ihre Liganden erst später gefunden wurden, werden sie als orphan nuclear receptors bezeichnet.

28 9. VorlesungModern Methods in Drug Discovery WS05/0628 Human Orphan Nuclear Receptors Receptor (Gene ID)Natural ligand (synthetic ligand) CAR (NR1I3)3,5 -Androstanol COUP (NR2F1)– ERR (NR3B1)(4-Hydroxytamoxifen) FXR (NR1H4)Chenodeoxycholic acid HNF4 (NR2A1)Palmitic acid LRH (NR5A2)– PPAR (NR1C1)Eicosapentaenoic acid PXR (NR1I2)5 -Pregnane-3,20-dione, (Rifampicin) ROR (NR1F1)Stearic acid RXR (NR2B1)9-cis-RNA Auswahl, mehr in der angebenen Literatur Lit: T.M.Wilson & J.T. Moore Mol. Endocrin. 16 (2002) 1135.

29 9. VorlesungModern Methods in Drug Discovery WS05/0629 Induktion und Regelung von CYP3A (III) Hyperforin, der natürliche Bestandteil des St. Johns wort (Johanniskraut, Hypericum performatum) zeigt die bisher höchste gemessene Affinität zu PXR (K d = 27 nM) Anwendung: Heilmittel gegen Gallestauung (cholestasis) sowie als mildes Antidepressivuum

30 9. VorlesungModern Methods in Drug Discovery WS05/0630 Induktion und Regelung von CYP3A (IV) Struktur von PXR mit Hyperforin (1M13.pdb) Lit: R.E. Watkins et al. Biochemistry 42 (2003) 1430

31 9. VorlesungModern Methods in Drug Discovery WS05/0631 Induktion weiterer CYP CYP 1A2omeprazole, insulin, aromatic hydrocarbons (cigarette smoking, charbroiled meat) CYP 2C9rifampicin, secobarbital CYP 2C19carbamazepine, prednisone CYP 2D6dexamethason CYP 2E1ethanol, isoniazid CYP 3A4glucocorticoide, phenobarbitone, rifampicin, nevirapine, sulfadimindine, nevirapine, sulfinpyrazone, troglitazone Führt zu erhöhter Coffein-Konzentration im Plasma wenn man aufhört zu Rauchen

32 9. VorlesungModern Methods in Drug Discovery WS05/0632 Typische Inhibitoren von CYP (I) CYP 1A2cimetidine, ciprofloxacine, enoxacine... grapefruit juice (naringin, 6,7-dihydroxy- bergamottin) CYP 2C9chloramphenicol, amiodarone, omeprazole,... CYP 2C19fluoxetine, fluvastatin, sertraline,... CYP 2D6fluoxetine, paroxetine, quinidine, haloperidol, ritonavir,... CYP 2E1disulfiram, cimetidine,... CYP 3A4cannabinoids, erythromycin, ritonavir, ketokonazole, grapefruit juice siehe

33 9. VorlesungModern Methods in Drug Discovery WS05/0633 Transporter (I) Im Gegensatz zur passiven Diffusion durch Membranen, bewirken Transporter verstärkten influx in, oder efflux aus Kompartimenten, wobei ATP verbraucht wird. Lit: A.Ayrton et al. Xenobiotica 31 (2001) 469

34 9. VorlesungModern Methods in Drug Discovery WS05/0634 Transporter (II) Membranständige Transporter die an der Pharmakokinetik von endogenden Stoffen beteiligt sind Lit: M.K.Leabman et al. Proc.Nat.Acad.Sci.USA 100 (2003) 5896 Superfamilien: solute carriers (SLC) ATP-binding cassette (ABC) P-type ATPase

35 9. VorlesungModern Methods in Drug Discovery WS05/0635 Struktur von Membrantransportern Membrantransporter sind Proteine mit teilweise über 12 Transmembranhelices die über Loops verbunden sind. Bisher gelang die Strukturaufklärung mittels X-ray noch bei keinem Transporter. Lit: M.K.Leabman et al. Proc.Nat.Acad.Sci.USA 100 (2003) 5896

36 9. VorlesungModern Methods in Drug Discovery WS05/0636 P-glycoprotein P-gp gehört zur Familie der multidrug resistant proteins (MDR) und wird von dem MDR1 Gen kodiert. Insbesondere die Bioverfügbarkeit von Psychopharmaka wird limitiert durch den Rücktransport aus dem Gehirn in den Blutkreislauf. Transport von Stoffen aus der Leber in den gastrointestinalen Trakt (bilary excretion) z.B. von Indinavir Die Überexpression von P-gp führt bei Krebszellen zu Resistenz gegen Antineoplastica. Lit: A.Ayrton et al. Xenobiotica 31 (2001) 469. A.Seelig Eur.J.Biochem. 251 (1998) 252.

37 9. VorlesungModern Methods in Drug Discovery WS05/0637 Transportproteine für Organische Ionen Dazu gehören die Familien der Organic Anion Transporter (OAT) und der Organic Cation Transporter (OCT) Diese sind vor allem an der Ausscheidung hydrophiler Katabolite beteiligt Lit: A.Ayrton et al. Xenobiotica 31 (2001) 469

38 9. VorlesungModern Methods in Drug Discovery WS05/0638 Transportproteine für influx Es gibt aber auch Transporter für die aktive Aufnahme von Stoffen aus dem Dünndarm Pept1 (intestinal peptide transporter) Transmembranprotein mit 12 TM-Helices Verantwortlich für Stickstoffaufnahme ! Substrate: kleine Peptide (Di- und Tripeptide, sowie Verbindungen mit Peptidcharakter, z.B. Captopril)

39 9. VorlesungModern Methods in Drug Discovery WS05/0639 Polymorphismus bei Transportern Auch Transporter weisen erhebliche genetische Variationen auf: GenProtein / Funktion ABCB1 (ATP-binding cassette subfamily B member 1) P-gp efflux SLC6A3 (Dopamine Transporter) Neurotransmitter SLC6A4 (Serotonin Transporter) Neurotransmitter ADRB2 ( -adrenergic receptor) Rezeptor für Betablocker ALOX5 (Arachidonate 5-lipoxygenase) Biosynthese von Leukotrienen Siehe: D.B.Goldstein et al. Nature Rev. Genetics 4 (2003) 937.


Herunterladen ppt "9. VorlesungModern Methods in Drug Discovery WS05/061 Cytochrom P450, Polymorphismus, Transporter."

Ähnliche Präsentationen


Google-Anzeigen