Die Präsentation wird geladen. Bitte warten

Die Präsentation wird geladen. Bitte warten

Analyse von Makromolekülen mit der MALDI-TOF-Massenspektrometrie in der Molekularen Medizin Andreas Humeny Lehrstuhl für Biochemie und Molekulare Medizin.

Ähnliche Präsentationen


Präsentation zum Thema: "Analyse von Makromolekülen mit der MALDI-TOF-Massenspektrometrie in der Molekularen Medizin Andreas Humeny Lehrstuhl für Biochemie und Molekulare Medizin."—  Präsentation transkript:

1 Analyse von Makromolekülen mit der MALDI-TOF-Massenspektrometrie in der Molekularen Medizin Andreas Humeny Lehrstuhl für Biochemie und Molekulare Medizin Institut für Biochemie Emil-Fischer-Zentrum Friedrich-Alexander Universität Erlangen-Nürnberg

2 DNAProteinRNA GenomicsProteomicsTranscriptomics Andreas Humeny Lehrstuhl für Biochemie und Molekulare Medizin Institut für Biochemie Emil-Fischer-Zentrum Friedrich-Alexander Universität Erlangen-Nürnberg Molekulare Medizin Analyse von Makromolekülen mit MALDI-TOF-MS in der Molekularen Medizin DiagnostikTherapie Krankheit Prävention BioanalytikBioinformatik

3 Andreas Humeny Lehrstuhl für Biochemie und Molekulare Medizin Institut für Biochemie Emil-Fischer-Zentrum Friedrich-Alexander Universität Erlangen-Nürnberg MALDI-TOF Massenspektrometrie Matrix Assisted Laser Desorption Ionization Time Of Flight Laser Optik Feldfreie Driftstrecke Detektor Beschleunigungsstrecke Target Beschleunigungselektrode Matrix-Biomolekül-Kokristalle Analyse von Makromolekülen mit MALDI-TOF-MS in der Molekularen Medizin

4 Andreas Humeny Lehrstuhl für Biochemie und Molekulare Medizin Institut für Biochemie Emil-Fischer-Zentrum Friedrich-Alexander Universität Erlangen-Nürnberg Matrizes für die MALDI-TOF-MS OH HCC CN COOH OH COOH HO COOH N N OH -Cyano-4-hydroxyzimtsäure (CCA): - Peptide bis ca. 5 kDa Trans-3,5-Dimethoxy-4-hydroxyzimtsäure (Sinapinsäure, SA): - Peptide ab ca. 3 kDa - Proteine 2,5-Dihydroxybenzoesäure (DHB): - Proteine - Glykoproteine - Kohlenhydrate Pikolinsäure (PA): - DNA - RNA OH HCC H COOH CH 3 H3CH3C O O 3-Hydroxypikolinsäure (3-HPA): - DNA - RNA Analyse von Makromolekülen mit MALDI-TOF-MS in der Molekularen Medizin

5 Andreas Humeny Lehrstuhl für Biochemie und Molekulare Medizin Institut für Biochemie Emil-Fischer-Zentrum Friedrich-Alexander Universität Erlangen-Nürnberg Fulleren-Analyse mit MALDI-TOF-MS Rel.Int. rel. int. rel. Int. Rel.Int. m/z Fulleren monoisotopische Massen Isotopenauflösung natürliche Isotopenverteilung: 12 C 98,890 % 13 C 1,110 % 14 N 99,634 % 15 N 0,366 % 16 O 99,762 % 17 O 0,038 % 18 O 0,200 % 1 H 99,985 % 2 H 0,015 % Molekularer Fußball: Definiertes Regio-Isomer C 93 H 48 O 12 mit C 60 -Kern monoisotopische Masse: 1356,3149 Da Isotopen- Signal Theoretische Verteilung [%] Experimentelle Signal-Höhen [%] Experimentelle Signal-Integrale [%] 0 94,99 92,81 93, , ,41 55,23 53, ,34 21,25 20,47 4 5,86 6,94 6, m/z Analyse von Makromolekülen mit MALDI-TOF-MS in der Molekularen Medizin

6 Andreas Humeny Lehrstuhl für Biochemie und Molekulare Medizin Institut für Biochemie Emil-Fischer-Zentrum Friedrich-Alexander Universität Erlangen-Nürnberg Quantifizierung mit MALDI-TOF-MS Generelle Aspekte: - Kein direkter Vergleich zwischen einzelnen Signalen aus verschiedenen Spektren - aber: Intraspektraler Vergleich relativer Signal-Höhen- bzw Signal-Integral-Verhältnisse mit internen Standards (direkt aus biologischer Probe oder nach Zugabe) - potentielle Probleme: Heterogene Verteilung der Biomoleküle im Kristall (sweet-spots) Verunreinigung der Probe (Adduktbildung z.B. mit Na + oder K + ) Inhomogene Desorptions- und Ionisations-Eigenschaften der Biomoleküle Definition des Hintergrunds und der Signale - Lösungsansätze: Summation vieler Laserschüssen an unterschiedliche Positionen zur Mittelung standardisierte Probenvorbereitung und Präparation des Ko-Kristalls Mehrfachansätze jeder Einzelprobe (z.B. Triplikate) und statistische Analyse automatisierte Messung und Auswertung Analyse von Makromolekülen mit MALDI-TOF-MS in der Molekularen Medizin

7 Andreas Humeny Lehrstuhl für Biochemie und Molekulare Medizin Institut für Biochemie Emil-Fischer-Zentrum Friedrich-Alexander Universität Erlangen-Nürnberg Analyse mit MALDI-TOF-MS Anwendungen: - DNA Level (Genomics): SNP-Analytik Mikrosatelliten-Instabilität (MSI) Verlust der Heterozygotie (LOH) DNA-Methylierung - RNA Level (Transcriptomics): Expressions-Analytik - Protein Level (Proteomics): Protein-Identifizierung Protein-Modifizierung Protein-Quantifizierung - Lipid Level (Lipidomics): Lipid-Komposition Analyse von Makromolekülen mit MALDI-TOF-MS in der Molekularen Medizin

8 Andreas Humeny Lehrstuhl für Biochemie und Molekulare Medizin Institut für Biochemie Emil-Fischer-Zentrum Friedrich-Alexander Universität Erlangen-Nürnberg - Genomics - MALDI-TOF-MS in der DNA-Analytik Analyse von Makromolekülen mit MALDI-TOF-MS in der Molekularen Medizin

9 Andreas Humeny Lehrstuhl für Biochemie und Molekulare Medizin Institut für Biochemie Emil-Fischer-Zentrum Friedrich-Alexander Universität Erlangen-Nürnberg Der Mensch ? Analyse von Makromolekülen mit MALDI-TOF-MS in der Molekularen Medizin

10 Andreas Humeny Lehrstuhl für Biochemie und Molekulare Medizin Institut für Biochemie Emil-Fischer-Zentrum Friedrich-Alexander Universität Erlangen-Nürnberg Die Menschen ! Analyse von Makromolekülen mit MALDI-TOF-MS in der Molekularen Medizin

11 Andreas Humeny Lehrstuhl für Biochemie und Molekulare Medizin Institut für Biochemie Emil-Fischer-Zentrum Friedrich-Alexander Universität Erlangen-Nürnberg Ausprägung der Individualität Individualität Gene Umwelt Analyse von Makromolekülen mit MALDI-TOF-MS in der Molekularen Medizin

12 Andreas Humeny Lehrstuhl für Biochemie und Molekulare Medizin Institut für Biochemie Emil-Fischer-Zentrum Friedrich-Alexander Universität Erlangen-Nürnberg Risiko Management Analyse von Makromolekülen mit MALDI-TOF-MS in der Molekularen Medizin

13 Andreas Humeny Lehrstuhl für Biochemie und Molekulare Medizin Institut für Biochemie Emil-Fischer-Zentrum Friedrich-Alexander Universität Erlangen-Nürnberg Risiko Management Risiko Analyse von Makromolekülen mit MALDI-TOF-MS in der Molekularen Medizin

14 Andreas Humeny Lehrstuhl für Biochemie und Molekulare Medizin Institut für Biochemie Emil-Fischer-Zentrum Friedrich-Alexander Universität Erlangen-Nürnberg CCATGATCAGAGCAGTTCAACC AGGGGAAACCTATACTTATAAG TGGAACATCTTAGAGTTTGATG AACCCACAGAAAATGATGCCCA GTGCTTAACAAGACCATACTAC AGTGACGTGGACATCATGAGAG ACATCGCCTCTGGGCTAATAGG ACTACTTCTAATCTGTAAGAGC AGATCCCTGGACAGGCGAGGAA TACAGGTATTTTGTCCTTGAAG TAACCTTTCAGAAATTCTGAGA ATTTCTTCTGGCTAGAACATGT TAGGTCTCCTGGCTAAATAATG GGGCATTTCCTTCAAGAGAACA CCATGATCAGAGCAGTTCAACC AGGGGAAACCTATACTTATAAG TGGAACATCTTAGAGTTTGATG AACCCACAGAAAATGATGCCCA GTGCTTAACAAGACCATACTAC AGTGACGTGGACATCATGAGAG ACATCGCCTCTGGGCTAATAGG ACTACTTCTAATCTGTAAGAGC AGATCCCTGGACAGGCAAGGAA TACAGGTATTTTGTCCTTGAAG TAACCTTTCAGAAATTCTGAGA ATTTCTTCTGGCTAGAACATGT TAGGTCTCCTGGCTAAATAATG GGGCATTTCCTTCAAGAGAACA Risiko Management Analyse von Makromolekülen mit MALDI-TOF-MS in der Molekularen Medizin

15 Andreas Humeny Lehrstuhl für Biochemie und Molekulare Medizin Institut für Biochemie Emil-Fischer-Zentrum Friedrich-Alexander Universität Erlangen-Nürnberg CCATGATCAGAGCAGTTCAACC AGGGGAAACCTATACTTATAAG TGGAACATCTTAGAGTTTGATG AACCCACAGAAAATGATGCCCA GTGCTTAACAAGACCATACTAC AGTGACGTGGACATCATGAGAG ACATCGCCTCTGGGCTAATAGG ACTACTTCTAATCTGTAAGAGC AGATCCCTGGACAGGCGAGGAA TACAGGTATTTTGTCCTTGAAG TAACCTTTCAGAAATTCTGAGA ATTTCTTCTGGCTAGAACATGT TAGGTCTCCTGGCTAAATAATG GGGCATTTCCTTCAAGAGAACA CCATGATCAGAGCAGTTCAACC AGGGGAAACCTATACTTATAAG TGGAACATCTTAGAGTTTGATG AACCCACAGAAAATGATGCCCA GTGCTTAACAAGACCATACTAC AGTGACGTGGACATCATGAGAG ACATCGCCTCTGGGCTAATAGG ACTACTTCTAATCTGTAAGAGC AGATCCCTGGACAGGCAAGGAA TACAGGTATTTTGTCCTTGAAG TAACCTTTCAGAAATTCTGAGA ATTTCTTCTGGCTAGAACATGT TAGGTCTCCTGGCTAAATAATG GGGCATTTCCTTCAAGAGAACA Risiko Management Risiko Analyse von Makromolekülen mit MALDI-TOF-MS in der Molekularen Medizin

16 Andreas Humeny Lehrstuhl für Biochemie und Molekulare Medizin Institut für Biochemie Emil-Fischer-Zentrum Friedrich-Alexander Universität Erlangen-Nürnberg Genetische Heterogenität chromosomale Veränderungen Insertionen von Nukleotiden Deletionen von Nukleotiden Substitutionen von Nukleotiden (single nucleotide polymorphisms) ACGTCGCTGAC TGCAGCGACTG ACGTCGCTGAC TGCAGCGACTG ACGTCGCTGAC TGCAGCGACTG ACGTCAGCTGAC TGCAGTCGACTG ACGTCCTGAC TGCAGGACTG ACGTCACTGAC TGCAGTGACTG Analyse von Makromolekülen mit MALDI-TOF-MS in der Molekularen Medizin

17 Andreas Humeny Lehrstuhl für Biochemie und Molekulare Medizin Institut für Biochemie Emil-Fischer-Zentrum Friedrich-Alexander Universität Erlangen-Nürnberg Single nucleotide polymorphisms SNP Definition:- SNPs sind Einzelbasensubstitution mit einer Häufigkeit von mindestens 1 % in der betrachteten Population. bei weniger als 1 % Häufigkeit: Punktmutation SNP-Frequenzen:- 90% der genetischen Heterogenität bedingt durch SNPs - ca. 1 / über 2 Millionen SNPs identifiziert SNPs in den Genen: - SNPs in regulativen Regionen - ca SNPs in kodierenden Gen-Regionen - kodierende SNPs können zum Aminosäureaustausch führen SNP Identifizierung: - bioanalytisch: direkte Sequenzierung... - bioinformatisch: Algorithmen & Datenbanken (Data Mining) Analyse von Makromolekülen mit MALDI-TOF-MS in der Molekularen Medizin

18 Andreas Humeny Lehrstuhl für Biochemie und Molekulare Medizin Institut für Biochemie Emil-Fischer-Zentrum Friedrich-Alexander Universität Erlangen-Nürnberg Single nucleotide polymorphisms Positionsmarker Kartierung neuer Genorte Identitätsmarker Vaterschaft Forensik Täter Diagnostik Risikoallele Krankheitsallele Pharmakogenomik SNPs Analyse von Makromolekülen mit MALDI-TOF-MS in der Molekularen Medizin

19 Andreas Humeny Lehrstuhl für Biochemie und Molekulare Medizin Institut für Biochemie Emil-Fischer-Zentrum Friedrich-Alexander Universität Erlangen-Nürnberg Methoden zur Genotypisierung - Messung von sekundären Moleküleigenschaften: z.B. elektrophoretische Mobilität, chromatographisches Verhalten, Hybridisierung: - klassische und Kapillar-Sequenzierung - denaturierende HPLC - Chips - Messung einer absoluten, intrinsischen Moleküleigenschaft: Bestimmung der molekularen Masse mit MALDI-TOF Massenspektrometrie Analyse von Makromolekülen mit MALDI-TOF-MS in der Molekularen Medizin

20 Andreas Humeny Lehrstuhl für Biochemie und Molekulare Medizin Institut für Biochemie Emil-Fischer-Zentrum Friedrich-Alexander Universität Erlangen-Nürnberg Molekulare Massen der DNA-Bausteine O O O - O P O H H H H H N N N N NH 2 O O O - O P O H H H H H N NH O O H3CH3C O O O - O P O H H H H H N N O NH 2 Desoxyadenosin: 313 Da Desoxythymidin: 304 Da Desoxyguanosin: 329 Da Desoxycytosin: 289 Da 16 Da 15 Da 40 Da 9 Da 25 Da 24 Da O O O - O P O H H H H H N N NH O NH 2 N Analyse von Makromolekülen mit MALDI-TOF-MS in der Molekularen Medizin

21 Andreas Humeny Lehrstuhl für Biochemie und Molekulare Medizin Institut für Biochemie Emil-Fischer-Zentrum Friedrich-Alexander Universität Erlangen-Nürnberg Das Risiko wiegen ! Gen-Waage Analyse von Makromolekülen mit MALDI-TOF-MS in der Molekularen Medizin

22 Andreas Humeny Lehrstuhl für Biochemie und Molekulare Medizin Institut für Biochemie Emil-Fischer-Zentrum Friedrich-Alexander Universität Erlangen-Nürnberg MALDI-TOF Massenspektrometrie Matrix Assisted Laser Desorption Ionization Time Of Flight Laser Optik Feldfreie Driftstrecke Detektor Beschleunigungsstrecke Target Beschleunigungselektrode Matrix-Biomolekül-Kokristalle Analyse von Makromolekülen mit MALDI-TOF-MS in der Molekularen Medizin

23 Andreas Humeny Lehrstuhl für Biochemie und Molekulare Medizin Institut für Biochemie Emil-Fischer-Zentrum Friedrich-Alexander Universität Erlangen-Nürnberg MALDI-TOF-MS: Probenpräparation m/z Magnetische Partikel Reversed-Phase Chromatographie Amorphe Silikate Rel. Int. Initiale Probleme bei der MALDI-TOF-MS Analytik : - Komplexbildung der DNA mit Ionen (Natrium, Kalium...) - Abnehmende Sensitivität bei größeren Oligonukleotiden - Fragmentierung der DNA Lösungsansätze für die MALDI-TOF-MS Analytik : - Optimierte Reinigung und Probenpräparation - Optimiertes molekulares Design der Testsysteme - Verwendung geeigneter Matrices und Probenträger Analyse von Makromolekülen mit MALDI-TOF-MS in der Molekularen Medizin

24 Andreas Humeny Lehrstuhl für Biochemie und Molekulare Medizin Institut für Biochemie Emil-Fischer-Zentrum Friedrich-Alexander Universität Erlangen-Nürnberg Blutgerinnungskaskade Endogenes SystemExogones SystemFaktor IXaFaktor VIIaFaktor XFaktor XaFaktor X Faktor Va ProthrombinThrombinFibrinogenFibrin Analyse von Makromolekülen mit MALDI-TOF-MS in der Molekularen Medizin

25 Andreas Humeny Lehrstuhl für Biochemie und Molekulare Medizin Institut für Biochemie Emil-Fischer-Zentrum Friedrich-Alexander Universität Erlangen-Nürnberg Faktor V Leiden-Allel CCATGATCAGAGCAGTTCAACC AGGGGAAACCTATACTTATAAG TGGAACATCTTAGAGTTTGATG AACCCACAGAAAATGATGCCCA GTGCTTAACAAGACCATACTAC AGTGACGTGGACATCATGAGAG ACATCGCCTCTGGGCTAATAGG ACTACTTCTAATCTGTAAGAGC AGATCCCTGGACAGGCGAGGAA TACAGGTATTTTGTCCTTGAAG TAACCTTTCAGAAATTCTGAGA ATTTCTTCTGGCTAGAACATGT TAGGTCTCCTGGCTAAATAATG GGGCATTTCCTTCAAGAGAACA CCATGATCAGAGCAGTTCAACC AGGGGAAACCTATACTTATAAG TGGAACATCTTAGAGTTTGATG AACCCACAGAAAATGATGCCCA GTGCTTAACAAGACCATACTAC AGTGACGTGGACATCATGAGAG ACATCGCCTCTGGGCTAATAGG ACTACTTCTAATCTGTAAGAGC AGATCCCTGGACAGGCAAGGAA TACAGGTATTTTGTCCTTGAAG TAACCTTTCAGAAATTCTGAGA ATTTCTTCTGGCTAGAACATGT TAGGTCTCCTGGCTAAATAATG GGGCATTTCCTTCAAGAGAACA Normal-AllelLeiden-Allel Analyse von Makromolekülen mit MALDI-TOF-MS in der Molekularen Medizin

26 Andreas Humeny Lehrstuhl für Biochemie und Molekulare Medizin Institut für Biochemie Emil-Fischer-Zentrum Friedrich-Alexander Universität Erlangen-Nürnberg Faktor V Leiden-Allel Normal-AllelLeiden-Allel Faktor V ThrombinFaktor Va inaktiv Protein CFaktor Va X Stopp der Blutgerinnung X AKTIVIERUNG Gas INAKTIVIERUNG Bremse Analyse von Makromolekülen mit MALDI-TOF-MS in der Molekularen Medizin

27 Andreas Humeny Lehrstuhl für Biochemie und Molekulare Medizin Institut für Biochemie Emil-Fischer-Zentrum Friedrich-Alexander Universität Erlangen-Nürnberg Evolution beim Faktor V SNP Ethnie-Abhängigkeit: höchste Rate in Europa: G/A ca. 5 % A/A ca. 1: 5000 selten bei Afrikanern und Asiaten Auftreten ca. vor Jahren nach der Trennung der Kaukasier von Afrikanern und Asiaten Überlebensvorteil in prä-moderner Zeit: Reduzierte Mortalität bei Geburt und Verletzungen durch erhöhte Blutgerinnung balancierter Polymorphismus Und in heutiger Zeit ? Thromboserisiko ! Analyse von Makromolekülen mit MALDI-TOF-MS in der Molekularen Medizin

28 Andreas Humeny Lehrstuhl für Biochemie und Molekulare Medizin Institut für Biochemie Emil-Fischer-Zentrum Friedrich-Alexander Universität Erlangen-Nürnberg Faktor V Leiden und Thromboserisiko Klinische Ausprägung des Thromboserisikos beeinflußt durch A.) Anzahl der Faktor V Leiden-Allele: - Heterozygotie (G/A): 5 bis 10 -fach erhöhtes Thromboserisiko - Homozygotie (A/A): 80 bis 100 -fach erhöhtes Thromboserisiko B.) Anwesenheit von weiteren genetischen Heterogenitäten: - weitere Risikoerhöhung durch SNP G20210A im Prothrombin-Gen (Faktor II), ca. 3 % Prävalenz in Europa C.) weitere Risikofaktoren: - Alter, Operationen, anhaltende Immobilisierung, Rauchen, orale Kontrazeptiva, Schwangerschaft... Analyse von Makromolekülen mit MALDI-TOF-MS in der Molekularen Medizin

29 Faktor V Wildtyp 5´-AGAGCAGATCCCTGGACAGGAGAGGAATACAGA-3´ 3´-TCTCGTCTAGGGACCTGTCCTCTCCTTATGTCT-3´ Faktor V Leiden 5´-AGAGCAGATCCCTGGACAGGAAAGGAATACAGA-3´ 3´-TCTCGTCTAGGGACCTGTCCTTTCCTTATGTCT-3´ Extensionsprimer: CAGATCCCTGGACAGGA 5181 Da Reaktion mit dGTP und ddATP: Extensionsprodukt Faktor V Wildtyp CAGATCCCTGGACAGGAGA 5807 Da Extensionsprodukt Faktor V Leiden CAGATCCCTGGACAGGAA 5478 Da Andreas Humeny Lehrstuhl für Biochemie und Molekulare Medizin Institut für Biochemie Emil-Fischer-Zentrum Friedrich-Alexander Universität Erlangen-Nürnberg rel. int. Faktor V Leiden Genotypisierung m/z Probe A Probe B Primer 5181 A-Allel 5478 G-Allel 5807 Rel.Int. Probe A + 10 % Probe B Probe C Wasserkontolle Analyse von Makromolekülen mit MALDI-TOF-MS in der Molekularen Medizin

30 Andreas Humeny Lehrstuhl für Biochemie und Molekulare Medizin Institut für Biochemie Emil-Fischer-Zentrum Friedrich-Alexander Universität Erlangen-Nürnberg Etablierte SNP Testsystemen FV:1 SNPTLR4:1 SNP FII: 1 SNPTLR2:1 SNP GLRA1: 16 SNPsADRB1:7 SNP PR: 3 SNPsGRIN2B:2 SNP ACHE: 2 SNPsMYOC:1 SNP PPP2R3L: 7 SNPsCYP2D6:1 SNP HFE: 2 SNPsMDR1:1 SNP MTHFR:1 SNPTGFBRII:1 SNP PRNP:4 SNPsPrnp: 10 SNP APC:2 SNPs APC:4 Deletionen HBB: 10 SNPsHBB:2 Deletionen + 1 Insertion …… Analyse von Makromolekülen mit MALDI-TOF-MS in der Molekularen Medizin

31 Andreas Humeny Lehrstuhl für Biochemie und Molekulare Medizin Institut für Biochemie Emil-Fischer-Zentrum Friedrich-Alexander Universität Erlangen-Nürnberg Genomics und Automatisierung Map II Pure Genopure + Puredisk Prä-Analytik Anker-Targets AutoflexAnalytik GenotoolsPost-Analytik Analyse von Makromolekülen mit MALDI-TOF-MS in der Molekularen Medizin

32 Andreas Humeny Lehrstuhl für Biochemie und Molekulare Medizin Institut für Biochemie Emil-Fischer-Zentrum Friedrich-Alexander Universität Erlangen-Nürnberg DNA-Reinigung mit magnetischen Beads rel. int. Sass-to-Pure Map II Pure Puredisk MechanikZwei-Hand + Multipette 8-Nadel96-Nadel Probendurchsatzvariabel: 1-96rel. variabel: 32-96fest: 96 Reinigungsleistungsehr gutsehr gutsehr gut Zeitbedarfca. 90 Minutenca. 80 Minutenca. 60 Minuten Zuverlässigkeitprinzipiell hochhochhoch Verbrauch-LimitierungNerven, Sehnen, MuskelnSpitzenBinde- und Waschpuffer KostenPersonalAnschaffungAnschaffung Analyse von Makromolekülen mit MALDI-TOF-MS in der Molekularen Medizin

33 Andreas Humeny Lehrstuhl für Biochemie und Molekulare Medizin Institut für Biochemie Emil-Fischer-Zentrum Friedrich-Alexander Universität Erlangen-Nürnberg Anker-Targets Vorteile gegenüber herkömmlichen Targets: Hydrophobe Oberfläche mit hydrophilen Ankern - definierte Positionen für automatische Messung - Mikropräparation mit Makropipetten bzw. Robotik - reduzierte Sweet-Spots - homogenere Präparation Probenpositionen - erhöhte Sensitivität für Bioanalyte Analyse von Makromolekülen mit MALDI-TOF-MS in der Molekularen Medizin

34 Andreas Humeny Lehrstuhl für Biochemie und Molekulare Medizin Institut für Biochemie Emil-Fischer-Zentrum Friedrich-Alexander Universität Erlangen-Nürnberg Automatische Auswertung rel. int. Verlässlichkeit grünhoch gelb mittel rotniedrig graun.d. Genotypen dunkelblauA / A hellblauA / G rotG / G graun.d. Abnehmende Stringenz der Parameter der automatischen Auswertung sehr hochhochmittelgeringStringenz Analyse von Makromolekülen mit MALDI-TOF-MS in der Molekularen Medizin

35 Andreas Humeny Lehrstuhl für Biochemie und Molekulare Medizin Institut für Biochemie Emil-Fischer-Zentrum Friedrich-Alexander Universität Erlangen-Nürnberg Detektion somatischer Mutationen Mikrosatelliten-Instabilität: Verlust oder Einfügen repetitiver Einheiten in Mikrosatelliten Verursacht durch DNA-Polymerase Slippage und Defekte im MMR-System Schlüsselrolle in Genese und Progression von Tumoren Assoziation mit heriditärem nicht polypösem Kolonkarzinom (HNPCC) und in ca. 15 % aller sporadischen Tumore detektiert Detektion bisher über Gel-basierte Methoden (Bandenverschiebung) Bioinformatische Identifizierung von kodierenden Mikrosatelliten (> 17000/Genom) Analyse von Makromolekülen mit MALDI-TOF-MS in der Molekularen Medizin

36 Andreas Humeny Lehrstuhl für Biochemie und Molekulare Medizin Institut für Biochemie Emil-Fischer-Zentrum Friedrich-Alexander Universität Erlangen-Nürnberg Interne Quantifizierung Molare Verhältnisse (-1 Deletion / Wt) Signal-Integral Verhältnisse (-1 Deletion / Wt) 0,8 0,6 0,4 0,2 0,0 0,20,40,60,81,0 Bestimmung der intern Signal-Integral Verhältnisse mit MALDI-TOF-MS 1.) Messung verschiedener molarer Verhältnisse zweier synthetischer Oligonukleotide: 2.) Bestimmung der Signal-Integral-Verhältnisse Beispiel: Mikrosatellit im GART-Gen (Phosphoribosylglycinamid Formyltransferase-Gen) Extensionsprodukte: Mikrosatellit GART: Wt = 10 T AGCCACTCTGGCCTTTTTTTTTTC Mikrosatellit GART: -1 Deletion = 9 T AGCCACTCTGGCCTTTTTTTTTC Analyse von Makromolekülen mit MALDI-TOF-MS in der Molekularen Medizin

37 Andreas Humeny Lehrstuhl für Biochemie und Molekulare Medizin Institut für Biochemie Emil-Fischer-Zentrum Friedrich-Alexander Universität Erlangen-Nürnberg Mikrosatelliten-Instabilität: GART GART Wildtyp 5´-TTTGAAAAAAAAAAGGCCAGAGTGGCTGTCTTA-3´ 3´-AAACTTTTTTTTTTCCGGTCTCACCGACAGAAT-3´ Extensionsprimer: TTTTTTTCCGGTCTCACCGA 6026 Da Reaktion mit dTTP und ddCTP: Extensionsprodukt GART Wildtyp CTTTTTTTTTTCCGGTCTCACCGA 7211 Da Extensionsprodukt GART -1 Deletion CTTTTTTTTTCCGGTCTCACCGA 6907 Da Extensionsprodukt GART +1 Insertion CTTTTTTTTTTTCCGGTCTCACCGA 7515 Da Kontrolle Zell-Linie KM12 Primer Del 6907 Wt 7211 rel. int. m/z Rel.Int Patient 184 Kontrollgewebe Patient 184 Tumorgewebe Patient 218 Kontrollgewebe Patient 218 Tumorgewebe +1 Ins 7515 ! ! ! ! = MSI Analyse von Makromolekülen mit MALDI-TOF-MS in der Molekularen Medizin

38 Andreas Humeny Lehrstuhl für Biochemie und Molekulare Medizin Institut für Biochemie Emil-Fischer-Zentrum Friedrich-Alexander Universität Erlangen-Nürnberg Etablierte MSI Testsysteme GART:A 10 – MikrosatellitChromosom 21q22.1 AC1: T 10 - Mikrosatellit Chromosom 4p16 TGFBRII: A 10 - MikrosatellitChromosom 3p22 MSH3: A 8 - MikrosatellitChromosom 5q11-q12 MSH6: C 8 - Mikrosatellit Chromosom 2p16 Analyse von Makromolekülen mit MALDI-TOF-MS in der Molekularen Medizin

39 Andreas Humeny Lehrstuhl für Biochemie und Molekulare Medizin Institut für Biochemie Emil-Fischer-Zentrum Friedrich-Alexander Universität Erlangen-Nürnberg Verlust der Heterozygotie Zwei-Hit Modell der Tumorigenese: 1.) Keimbahn-Mutataion Heterozygotie 2.) Somatische Mutation Verlust der Heterozygotie (loss of heterozygosity, LOH) wichtig für Tumorsuppressor-Gene Verlust der Funktion (loss of function) Detektion von LOH mit MALDI-TOF-MS: - DNA Extraktion und PCR - Primerextensionsreaktion und MALDI-TOF-MS - relative Signalverhältnisse Vergleich von relativen Signalverhältnissen: Tumor- versus Kontrollgewebe TS-Gen (functional ) TS-Gen (dysfunctional) 1. Hit 2. Hit Analyse von Makromolekülen mit MALDI-TOF-MS in der Molekularen Medizin

40 Andreas Humeny Lehrstuhl für Biochemie und Molekulare Medizin Institut für Biochemie Emil-Fischer-Zentrum Friedrich-Alexander Universität Erlangen-Nürnberg Verlust der Heterozygotie LOH-Analyse mit MALDI-TOF-MS Potentielles Tumorsuppressor-Gen PPP2R3B: T/C SNP an Nukleotidposition Verlust des T-Allels bei Brustkrebs PatientGewebeSignal Integral Verhältnis (T/C) Signal Höhen Verhältnis (T/C) AKontrolle ATumor BKontrolle BTumor CKontrolle CTumor Rel.Int C-AllelT-AllelPrimer m/z Patient A: Kontrollgewebe Patient A: Tumorgewebe Patient B: Kontrollgewebe Patient B: Tumorgewebe ! ! = LOH ! Patient C: Kontrollgewebe Patient C: Tumorgewebe Extension:dTTP, ddATP und ddCTP PrimerTGAAGCGCTGCAAGCTGGC 5855 Da C-AllelTGAAGCGCTGCAAGCTGGCC 6128 Da T-AllelTGAAGCGCTGCAAGCTGGCTA 6456 Da Analyse von Makromolekülen mit MALDI-TOF-MS in der Molekularen Medizin

41 Andreas Humeny Lehrstuhl für Biochemie und Molekulare Medizin Institut für Biochemie Emil-Fischer-Zentrum Friedrich-Alexander Universität Erlangen-Nürnberg Verlust der Heterozygotie Kontrolgewebe Tumorgewebe n=4 A B C DPatient PPP2R3B: SNP T/C Signal Verhältnis (T /C) kein LOHLOH ! Analyse von Makromolekülen mit MALDI-TOF-MS in der Molekularen Medizin

42 Andreas Humeny Lehrstuhl für Biochemie und Molekulare Medizin Institut für Biochemie Emil-Fischer-Zentrum Friedrich-Alexander Universität Erlangen-Nürnberg DNA-Methylierung Bedeutung der DNA-Methylierung: Prokaryonten: Abwehrreaktion gegen Bakteriophagen in Kombination mit Restriktionsendonukleasen Timing der DNA-Replikation und DNA-Reparatur Regulation der Gen-Expression Eukaryonten: Repression der Gen-Expression: Entwicklungskontrolle, genomisches Imprinting, X-chromosomale Inaktivierung Herkömmliche Techniken zur Analyse der in vitro-DNA-Methylierung: Einsatz radioaktiver Methylierungsreagenzien Protektion der Restriktionsendonuklease-Reaktion Analyse von Makromolekülen mit MALDI-TOF-MS in der Molekularen Medizin

43 Andreas Humeny Lehrstuhl für Biochemie und Molekulare Medizin Institut für Biochemie Emil-Fischer-Zentrum Friedrich-Alexander Universität Erlangen-Nürnberg rel. int. rel. Int. DNA-Methylierung m/z m/z Min 1 Min 2 Min 5 Min 10 Min 20 Min 40 Min 60 Min DNA-Methylierung erfolgt durch die Methyltransferasen (MTasen). S-Adenosylmethionin (SAM) als Donor von aktivierten Methylgruppen. Beispiel: E. coli dam MTase erkennt Palindrom GATC: 5´-GCCCGGGGATCCGGCCGCG–3´ 5793 Da 3´-CGGGCCCCTAGGCCGGCGC- ( T ) 6 -Biotin 7672 Da CH 3 Methylierung führt zu einem definierten Anstieg der molekularen Masse des Oligonukleotids von 14 Da. Analyse mit MALDI-TOF-MS Analyse von Makromolekülen mit MALDI-TOF-MS in der Molekularen Medizin

44 Andreas Humeny Lehrstuhl für Biochemie und Molekulare Medizin Institut für Biochemie Emil-Fischer-Zentrum Friedrich-Alexander Universität Erlangen-Nürnberg DNA-Methylierung Genomische DNA-Methylierung geht bei PCR verloren. keine direkte Analyse mit MALDI-TOF-MS möglich! Chemische Reaktion mit Natrium-Bisulfit: unmethyliertes Cytosin Uracil (hydrolytische Deaminierung) methyliertes Cytosin resistent gegen Modifikation Nach Bisulfit-Behandlung und PCR: PCR-Fragmente mit T statt unmethyliertes C PCR-Fragmente mit C statt methyliertes C Virtueller C/T-SNP, der den positionsspezifischen Methylierungsstaus wiederspiegelt Primerextension und MALDI-TOF-MS Analyse von Makromolekülen mit MALDI-TOF-MS in der Molekularen Medizin

45 Andreas Humeny Lehrstuhl für Biochemie und Molekulare Medizin Institut für Biochemie Emil-Fischer-Zentrum Friedrich-Alexander Universität Erlangen-Nürnberg - Transcriptomics - MALDI-TOF-MS in der RNA-Analytik Analyse von Makromolekülen mit MALDI-TOF-MS in der Molekularen Medizin

46 Andreas Humeny Lehrstuhl für Biochemie und Molekulare Medizin Institut für Biochemie Emil-Fischer-Zentrum Friedrich-Alexander Universität Erlangen-Nürnberg Expressions-Analyse ABCD m/z Primer Ziel-Gen Primer Haushalts Gen ProductProdukt Ziel-GenHaushalts Gen Rel.Int. Extension Steigende Mengen der Ziel-Gen mRNA Ziel-Gen Haushalts-Gen Quantifizierung RNA Präparation Gewebepräparation RT-PCR Ko-Reinigung Primerextension Ko-Reinigung MALDI-TOF-MS Signal-Verhältnisse Analyse von Makromolekülen mit MALDI-TOF-MS in der Molekularen Medizin

47 Andreas Humeny Lehrstuhl für Biochemie und Molekulare Medizin Institut für Biochemie Emil-Fischer-Zentrum Friedrich-Alexander Universität Erlangen-Nürnberg Expressions-Analyse Ziel-Gene Glycin Rezeptor -Untereinheit (glrb) GABA-A Rezeptor 2-Untereinheit ( 2) GABA-A Rezeptor -Untereinheit ( ) Haushalts-Gene -Aktin Hypoxanthin-Guanin-Phosphoribosyl Transferase (HPRT) Analyse-Level murines Modell (Gewebe) klonierte Fragmente (Plasmide) synthetische Templat-Oligonukleotide Kontrollansätze TaqMan Light Cycler Analyse von Makromolekülen mit MALDI-TOF-MS in der Molekularen Medizin

48 Rel.Int. Andreas Humeny Lehrstuhl für Biochemie und Molekulare Medizin Institut für Biochemie Emil-Fischer-Zentrum Friedrich-Alexander Universität Erlangen-Nürnberg Expressions-Analyse glrb GACTATAGAGTTAACATTTTCTTGAGACAGAAATGGAAT GACCCCAGACTCAAGCTACCTAGTGACTTCAGAGGCT CAGATGCACTGACAGTTGACCCCACCATGTATAAGTG CTTGTGGAAACCTGACTTATTCTTTGCAAATGAAAAAA GTGCCAATTTTCATGATGTGACCCAAGAAAATATCCTG TTGTTTATCTTTCGGGATGGAGACGTCCTTGTGAGC Extension:ddGTP Primer:ACAGTTGACCCCACCAT5100 Da A ProduktACAGTTGACCCCACCATG 5413 Da B -Aktin TGAGACCTTCAACACCCCAGCCATGTACGTAGCCATC CAGGCTGTGCTGTCCCTGTATGCCTCTGGTCGTACCA CAGGCATTGTGATGGACTCCGGAGACGGGGTCACCC ACACTGTGCCCATCTACGAGGGCTATGCTCTCCCTCA CGCCATCCTGCGTCTGGACCTGGCTGGCCGGGACCC Extension:ddGTP Primer:TCCCTGTATGCCTCTGGTC5723 Da C Produkt:TCCCTGTATGCCTCTGGTCG 6036 Da D ABCD m/z C57/BL6 +/+ C3H/HeJ +/+ C57/BL6 s/s B6/C3H s/s Cortex von unterschiedlichen Mäusen (B/A) / (D/C) = relative Mengen des Ziel-GenTranskritps (D/C) = Verhältnis des -Aktin-Produkts (haushalts-Gen) (B/A) = Verhältnis des glrb-Produkts (Ziel-Gen) (B/A) (D/C) Analyse von Makromolekülen mit MALDI-TOF-MS in der Molekularen Medizin

49 Andreas Humeny Lehrstuhl für Biochemie und Molekulare Medizin Institut für Biochemie Emil-Fischer-Zentrum Friedrich-Alexander Universität Erlangen-Nürnberg - Proteomics - MALDI-TOF-MS in der Protein-Analytik Analyse von Makromolekülen mit MALDI-TOF-MS in der Molekularen Medizin

50 Andreas Humeny Lehrstuhl für Biochemie und Molekulare Medizin Institut für Biochemie Emil-Fischer-Zentrum Friedrich-Alexander Universität Erlangen-Nürnberg Die Bausteine der Proteine Monoisotopische molekulare Massen von Aminosäuren (-H 2 0) [Da] : Gly(G) 57,0215 Asp(D)115,0269 Ala(A) 71,0371 Gln(Q)128,0586 Ser (S) 87,0320 Lys(K)128,0950 Pro(P) 97,0528 Glu(E)129,0426 Val(V) 99,0684 Met(M)131,0405 Thr(T) 101,0477 His(H)137,0589 Cys(C) Phe(P)147,0684 Leu(L) 114,0841 Arg(R)156,1011 Ile(I) 114,0841 Tyr(Y)163,0633 Asn(N) 115,0269 Trp(W)186,0793 isobar m = 0,0364 Analyse von Makromolekülen mit MALDI-TOF-MS in der Molekularen Medizin

51 Andreas Humeny Lehrstuhl für Biochemie und Molekulare Medizin Institut für Biochemie Emil-Fischer-Zentrum Friedrich-Alexander Universität Erlangen-Nürnberg Modifizierungen der Proteine Veränderungen der monoisotopische molekularen Massen [Da]: Met Homoserin (CNBr-Abbau)- 29,9928Glykosylierung (N-Acextylglucosamin) + 203,0794 Gln Pyroglutaminsäure- 17,0265Liponsäure ( NH-Lys)+ 188,0330 Bildung von Disulfidbrücken- 2,0157Farnesylierung+ 204,1878 C-terminale Amidbildung- 0,9840Myristoylierung+ 210,1984 Methylester+ 14,0157Biotinylierung + 226,0776 Hydroxylierung / Met-Oxidation + 15,9959Addition Pyridoxalphosphat+ 231,0297 Formylierung+ 27,9949Palmitoylierung+ 238,2297 Acetylierung+ 42,0106Steaorylierung+ 266,2610 Carboxylierung+ 43,9898Geranylgeranylierung+ 272,2504 Phosphorylierung+ 79,9663 Addition N-Acetylneuraminsäure+ 291,0954 Sulfatierung + 79,9568 Addition Glutathion+ 305,0682 Glykosylierung (Pentose) + 132,0423Adenosylierung+ 329,0525 Glykosylierung (Hexosamin)+ 161,0688Addition Phosphopantethein+ 339,0780 Glykosylierung (Hexose)+ 162,0528ADP-Ribosylierung+ 541,0611 Analyse von Makromolekülen mit MALDI-TOF-MS in der Molekularen Medizin

52 Andreas Humeny Lehrstuhl für Biochemie und Molekulare Medizin Institut für Biochemie Emil-Fischer-Zentrum Friedrich-Alexander Universität Erlangen-Nürnberg rel. int. Protein Leitersequenzierung Spaltungen mit Carboxypeptidasen Detektion verkürzter Peptide mit MALDI-TOF-MS Massendifferenzen liefern Seqeunzinformation - Vorteile:- C-terminale Sequenzinformation - repetitive Sequenzen analysierbar - Detektion von Modifizierungen - Nachteile :- relativ kurze sequence tags - Leucine und Isoleucin: isobar rel. int. Beispiel: Amyloid Peptide m/z 1900 G YEVHH Q K L/I V Analyse von Makromolekülen mit MALDI-TOF-MS in der Molekularen Medizin

53 Andreas Humeny Lehrstuhl für Biochemie und Molekulare Medizin Institut für Biochemie Emil-Fischer-Zentrum Friedrich-Alexander Universität Erlangen-Nürnberg rel. int. Post Source Decay (PSD) Fragmentierung metastabiler Analyten in feldfreier Driftstrecke nach der Beschleunigung: P m + F + + F n Fragmentierung metastabiler Peptide meistens im Proteinrückgrat: N-term. Ladung: a-, b-, c- Serien C-term. Ladung: x-, y-, z- Serien rel. int. Example: Adrenocorticotrope Hormone (ACTH) adapted from Bioanaltyik, F.Lottspeich and H. Zorbas Spektrum Verlag (1998) Analyse von Makromolekülen mit MALDI-TOF-MS in der Molekularen Medizin

54 Andreas Humeny Lehrstuhl für Biochemie und Molekulare Medizin Institut für Biochemie Emil-Fischer-Zentrum Friedrich-Alexander Universität Erlangen-Nürnberg Massen-Finger-Prints 2D-Gel-Elektrophorese In-Gel-Verdau einzelner Spots MALDI-TOF-MS Datenbanksuche mit Massen-Finger-Prints Rel. Int. -Actin Rel. Int. no match Rel. Int. CyclophillinA Analyse von Makromolekülen mit MALDI-TOF-MS in der Molekularen Medizin

55 Andreas Humeny Lehrstuhl für Biochemie und Molekulare Medizin Institut für Biochemie Emil-Fischer-Zentrum Friedrich-Alexander Universität Erlangen-Nürnberg NR2B im neonatalen Herz NMDA-Rezeptor: - Excitatorischer Neurotransmitter-Rezeptor Ligand: Glutamat Ionenkanal Permeabilität für Na + und Ca 2+ - Hetero-Tetramer aus einer oligatorischer NR1- und variablen NR2 a-d -Untereinheiten - klassische Lokalisation: Nervensystem NR2B: RT-PCR-Analyse im neonatalen Rattenherz: NR2B: Westernblot-Analyse im neonatalen Rattenherz: CxHerz E 1 8 NR2B H O 2 a d u l t P 2 1 P 1 2 P 5 P 0 P 1 2 -Aktin M Primer Analyse von Makromolekülen mit MALDI-TOF-MS in der Molekularen Medizin

56 Andreas Humeny Lehrstuhl für Biochemie und Molekulare Medizin Institut für Biochemie Emil-Fischer-Zentrum Friedrich-Alexander Universität Erlangen-Nürnberg NR2B: Molekularer Interaktionspartner BSA-Kontrolle 180 kD-Protein >205 kD-Protein m/z SolIP 205 kD Ryanodin- Rezeptor A IP-Rezeptor SolIP kD B molekularer Interaktionspartner der NR2B-Untereinheit im neonatalen Rattenherz Ryanodin-Rezeptor Konfokale Laserscan-Mikroskopie: Immunpräzipitation und Westernblot-Analyse: Immunpräzipitation von Membranfraktionen mit Anti-NR2B-Antikörper SDS-PAGE Proteinfärbung ? NR2B ? In-Gel-Verdau MALDI-TOF-MS Massenfingerprints Datenbank- suche BSA NR2B Ryanodin Rezeptor NR2B Ryanodin-R. Überlagerung Analyse von Makromolekülen mit MALDI-TOF-MS in der Molekularen Medizin

57 Andreas Humeny Lehrstuhl für Biochemie und Molekulare Medizin Institut für Biochemie Emil-Fischer-Zentrum Friedrich-Alexander Universität Erlangen-Nürnberg Modifikationen von -Thymosinen m/z Rel.Int. ohne Modifikation einfache Modifikation doppelte Modifikation Peptid Mapping: nur Glutamine 23 und 36 modifiziert (Reaktivität, Vergänglichkeit) - Detektion intramolekulare Isopeptidbindungen zwischen spezifischen Lysinen und Gluatminen in vitro und in vivo ac-SDKPDMAEIEKFDKSKLKKTET Q EKNPLPSKETIE Q EK Q AGES - Substrate für Transglutaminasen Reaction mit Aminogruppen - 3 Glutaminreste (Q) an Positionen 23, 36 und 39: - -Thymosine: Familile von 5 kDa Peptiden - Funktion: intrazellulär:Sequestrierung von G-Aktin Regulation des Cytoskeletts extrazellulär:Blutgerinnung und Wundheilung Analyse von Makromolekülen mit MALDI-TOF-MS in der Molekularen Medizin

58 Andreas Humeny Lehrstuhl für Biochemie und Molekulare Medizin Institut für Biochemie Emil-Fischer-Zentrum Friedrich-Alexander Universität Erlangen-Nürnberg Glykierung von Proteinen Bei der nicht-enzymatischen Glykierung werden im Unterschied zur enzymatischen Glykosylierung die Aminosäureseitenketten von Lysin und Arginin modifiziert ! 1.) Reaktion von reduzierenden Zuckern (z. B. Glucose) mit Aminogruppen eines Proteins unter Ausbildung von Schiffschen Basen (reversibel) 2.) Amadori-Umlagerung (reversibel) 3.) Nachgeschaltete Abbaureaktionen führen zu Advanced Glycation Endproducts (irreversibel) Bedeutung:- Medizin: Diabetes mellitus mit diversen Folgeschäden z.B. Retinopathie, renale Dysfunktion - Lebensmittelchemie: Bräunungsreaktionen (Maillard-Reaktion) Analyse von Makromolekülen mit MALDI-TOF-MS in der Molekularen Medizin

59 Andreas Humeny Lehrstuhl für Biochemie und Molekulare Medizin Institut für Biochemie Emil-Fischer-Zentrum Friedrich-Alexander Universität Erlangen-Nürnberg Advanced Glycation Endproducts m 58 Da m 72 Da m 144 Da m 54 Da Carboxymethyl-Lysin (CML) Carboxyethyl-Lysin (CEL) Imidazolon A Methylimidazolon Lysin spezifische ProdukteArginin spezifische Produkte Analyse von Makromolekülen mit MALDI-TOF-MS in der Molekularen Medizin

60 Andreas Humeny Lehrstuhl für Biochemie und Molekulare Medizin Institut für Biochemie Emil-Fischer-Zentrum Friedrich-Alexander Universität Erlangen-Nürnberg Glykierung intakter Proteine rel. int m/z natives Lysozym CML-Lysozym CEL-Lysozym 3-Desoxyglucoson-Lysozym Methylglyoxal-Lysozym glykiertes Lysozym Rel.Int Analyse von Makromolekülen mit MALDI-TOF-MS in der Molekularen Medizin

61 Andreas Humeny Lehrstuhl für Biochemie und Molekulare Medizin Institut für Biochemie Emil-Fischer-Zentrum Friedrich-Alexander Universität Erlangen-Nürnberg Glykierung und Peptide rel. int. GlukoseGlu-C-Spaltung MALDI-TOF-MS LysozymAGE-Lysozym m/z NH 2 KVFGRCE 838 NH KVFGRCE CH 2 O CH 2 OH OH OH OH H H H 1000 NH KVFGRCE CH 2 O OH 896 VQAWIRGCRL NH NNH O C 4 O 3 H 9 VQAWIRGCRL NH NHNH AmadoriCMLImidazolon Analyse von Makromolekülen mit MALDI-TOF-MS in der Molekularen Medizin

62 Andreas Humeny Lehrstuhl für Biochemie und Molekulare Medizin Institut für Biochemie Emil-Fischer-Zentrum Friedrich-Alexander Universität Erlangen-Nürnberg Quantifizierung der Glykierung rel. int. rel. Int. rel. int. m/z CML Amadori Rel.Int. ohne Glukose 1 Woche Glukose 4 Woche Glukose 8 Woche Glukose 16 Woche Glukose Inkubationsdauer [Wochen] % des totalen Integrals unmodifiziert CML Amadori Analyse von Makromolekülen mit MALDI-TOF-MS in der Molekularen Medizin

63 Andreas Humeny Lehrstuhl für Biochemie und Molekulare Medizin Institut für Biochemie Emil-Fischer-Zentrum Friedrich-Alexander Universität Erlangen-Nürnberg Rel.Int. rel. int. m/z rel. Int Poly-L-Lysin 8000 Molekulare Heterogenität: Poly-L-Lysin Analyse von Makromolekülen mit MALDI-TOF-MS in der Molekularen Medizin

64 Andreas Humeny Lehrstuhl für Biochemie und Molekulare Medizin Institut für Biochemie Emil-Fischer-Zentrum Friedrich-Alexander Universität Erlangen-Nürnberg Zusammenfassung Proteinanalytik Biologisches Material 2D-Gel- ElektrophoreseProtein-Reinigung Crosslink In-Gel-VerdauProtein-VerdauExoproteasen MALDI - TOF Massenspektrometrie Massen-Finger-Print Datenbanken Peptid-Leiter Masse des intakten Proteins Sequenz- Information (1 o -Struktur) Identifizierung bekannter Proteine Detektion unbekannter Proteine Analyse von Protein- Modifizierungen Analyse von 3 o - und 4 o - Strukturen Analyse von Makromolekülen mit MALDI-TOF-MS in der Molekularen Medizin

65 Andreas Humeny Lehrstuhl für Biochemie und Molekulare Medizin Institut für Biochemie Emil-Fischer-Zentrum Friedrich-Alexander Universität Erlangen-Nürnberg Protein Separation & Clinical Proteomics Chemische Oberflächen – Protein Expressions Profiling: HydrophobAnionischIMACNormael PhaseKationisch aktivierte Oberflächen AK-AGRezeptor - LigandDNA - Protein Biologische Oberflächen – Protein Interaktions Assays: SELDI-TOF-MS (adapted from Ciphergen) MALDI-TOF-MS Magnetische Beads ProteinChips (adapted from Villanueva et al. 2004) Bead Suspension Bindung: Waschen: Beads Serum Waschen und Sammeln: Elution: MALDI-Probenpräparation: Puffer Matrix Eluat MALDI Target Analyse von Makromolekülen mit MALDI-TOF-MS in der Molekularen Medizin

66 Andreas Humeny Lehrstuhl für Biochemie und Molekulare Medizin Institut für Biochemie Emil-Fischer-Zentrum Friedrich-Alexander Universität Erlangen-Nürnberg ProteinChips und SELDI-TOF-MS …ISEVXXDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA … peptide peptide Analysis von Amyloid Varianten: NTA4 mAb peptide Peptid Biomarker Profiling: 1.) ProteinChip: Ionenaustausch Chromatographie 2 biologische Proben (A und B): pH 10, 8, 6 und 4 2.) SELDI-TOF-MS Analyse: pH Probe 10 A 10 B 8 A 8 B 6 A 6 B 4 A 4 B Analyse von Makromolekülen mit MALDI-TOF-MS in der Molekularen Medizin

67 Andreas Humeny Lehrstuhl für Biochemie und Molekulare Medizin Institut für Biochemie Emil-Fischer-Zentrum Friedrich-Alexander Universität Erlangen-Nürnberg ProteinChips und SELDI-TOF-MS Flad et al Dermcidin Analyse von Schweiss ProteinChips und SELDI-TOF-MS Insulin Analyse von Makromolekülen mit MALDI-TOF-MS in der Molekularen Medizin

68 Andreas Humeny Lehrstuhl für Biochemie und Molekulare Medizin Institut für Biochemie Emil-Fischer-Zentrum Friedrich-Alexander Universität Erlangen-Nürnberg MALDI-TOF-MS & Clinical Proteomics Vergleich von chromatografischen Beads - Mischung von 7 Peptiden (1 kDa - 3 kDa) - Chromatographie auf magn. Beads (HIC, IMAC, WAX, WCX) - MALDI-TOF-MS Analyse (linearer Modus), Matrix HCCA m/z WCX WAX HIC IMAC Angiotensin IIACTH (1-17)Somatostatin 28 Rel.Int Angiotensin I Substance P BombesinACTH (18-39) Vergleich von chromatografischen Beads - menschliches Serum - Chromatographie auf magn. Beads (HIC, IMAC, WAX, WCX) - MALDI-TOF-MS Analyse (linearer Modus), Matrix HCCA Rel.Int. m/z WCX WAX HIC IMAC Analyse von Makromolekülen mit MALDI-TOF-MS in der Molekularen Medizin

69 Zellkulturüberstand m/z Kontrolle 24h BBTx Rel.Int. Zellkulturüberstand - Gift einer Taiwanesischen Giftschlange (banded krait Bungarus multicinctus): Beta-Bungarotoxin (BBTx) - BBTx induziert neuronale Apoptose (hippocampale Kulturen): - Bindung an spannungsabhängige K + Kanäle - Internalisierung - Anstieg von intrazellulärem Ca 2+ - Anstieg reaktiver Sauerstoffspezies (ROS) - Modifizierung von Proteinen und Lipiden - Apoptose Andreas Humeny Lehrstuhl für Biochemie und Molekulare Medizin Institut für Biochemie Emil-Fischer-Zentrum Friedrich-Alexander Universität Erlangen-Nürnberg MALDI-TOF-MS & Clinical Proteomics Zellkulturüberstand m/z Kontrolle 24h BBTx Rel.Int. Analyse von Makromolekülen mit MALDI-TOF-MS in der Molekularen Medizin

70 Andreas Humeny Lehrstuhl für Biochemie und Molekulare Medizin Institut für Biochemie Emil-Fischer-Zentrum Friedrich-Alexander Universität Erlangen-Nürnberg - Lipidomics - MALDI-TOF-MS in der Lipid-Analytik Analyse von Makromolekülen mit MALDI-TOF-MS in der Molekularen Medizin

71 Andreas Humeny Lehrstuhl für Biochemie und Molekulare Medizin Institut für Biochemie Emil-Fischer-Zentrum Friedrich-Alexander Universität Erlangen-Nürnberg Lipid-Analyse mit MALDI-TOF-MS rel. int m/z Phosphatidyl- cholin rel. int. Rel.Int. m/z760 Rel.Int. m/z810 Rel.Int. m/z 790 Rel.Int. 780 ABC Signalbereiche A B C PC 16:0 / 18:2 oder PC 16:1 / 18:1 oder PC 16:2 / 18:0 3PC 16:0 / 18:1 oder PC 16:1 / 18:0 5PC 16:0 / 18:0 1PC 16:0 / 22:6 oder Na + -Shifts von B6-B9 ? 3PC 18:1 / 20:4 oder... 5PC 18:0 / 20:4 oder Na + -Shifts von A1-A5 ? 3PC 16:0 / 20:4 6PC 18:0 / 18:2 oder... PC 18:1 / 18:1 8PC 18:0 / 18: Analyse von Makromolekülen mit MALDI-TOF-MS in der Molekularen Medizin

72 Andreas Humeny Lehrstuhl für Biochemie und Molekulare Medizin Institut für Biochemie Emil-Fischer-Zentrum Friedrich-Alexander Universität Erlangen-Nürnberg MALDI-TOF-MS MALDI TOF MS AuflösungSensitivitätGenauigkeit Quantifizierung GeschwindigkeitAutomatisierungHochdurchsatz ReproduzierbarkeitPoolen & Multiplex Kosteneffizienz Analyse von Makromolekülen mit MALDI-TOF-MS in der Molekularen Medizin

73 Andreas Humeny Lehrstuhl für Biochemie und Molekulare Medizin Institut für Biochemie Emil-Fischer-Zentrum Friedrich-Alexander Universität Erlangen-Nürnberg Danksagung Institut für Biochemie (Universität Erlangen-Nürnberg) Cord-Michael Becker Kristina Becker Katrin Schiebel Silke Seeber Daniela Gockenhammer Andre Reuland Thomas Bonk Julia Brill Nadine Balbus Claudia Sass Thomas Kislinger Klinik für Frauenheilkunde (Universität Erlangen-Nürnberg) Mattias Beckmann Reiner StrickPamela Strissel Ludwig Wildt Alexander Berkholz Michael Bauer Insitut für Pharmazie und Lebensmittelchemie (Universität Erlangen-Nürnberg) Monika Pischetsrieder Carlo PeichJasmin Meltretter Molekulare Diagnostik (Universität Heidelberg) Magnus von Knebel-DöberitzJohannes GebbertChristian Sutter Bruker Daltonik GmbH (Bremen und Leipzig) Jochen FranzenUwe RappMarkus Kostrzewa Analyse von Makromolekülen mit MALDI-TOF-MS in der Molekularen Medizin


Herunterladen ppt "Analyse von Makromolekülen mit der MALDI-TOF-Massenspektrometrie in der Molekularen Medizin Andreas Humeny Lehrstuhl für Biochemie und Molekulare Medizin."

Ähnliche Präsentationen


Google-Anzeigen